KEGG   Ursus arctos horribilis: 113243380
Entry
113243380         CDS       T05909                                 

Gene name
BBC3
Definition
(RefSeq) bcl-2-binding component 3
  KO
K10132  Bcl-2-binding component 3
Organism
uah  Ursus arctos horribilis
Pathway
uah01524  Platinum drug resistance
uah04115  p53 signaling pathway
uah04210  Apoptosis
uah04215  Apoptosis - multiple species
uah04390  Hippo signaling pathway
uah05016  Huntington disease
uah05162  Measles
uah05200  Pathways in cancer
uah05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    113243380 (BBC3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    113243380 (BBC3)
   04215 Apoptosis - multiple species
    113243380 (BBC3)
   04115 p53 signaling pathway
    113243380 (BBC3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113243380 (BBC3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    113243380 (BBC3)
  09164 Neurodegenerative disease
   05016 Huntington disease
    113243380 (BBC3)
  09172 Infectious disease: viral
   05162 Measles
    113243380 (BBC3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    113243380 (BBC3)
SSDB
Motif
Pfam: PUMA Hepatitis_core
Other DBs
NCBI-GeneID: 113243380
NCBI-ProteinID: XP_026337757
UniProt: A0A3Q7UNR3
LinkDB
Position
Unknown
AA seq 193 aa
MARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGLCEPGLPSAPAAPALLPAAYLC
APTAPPAVTAALGGPRWPGGPRSRPRGPRPDGPQPSLSPAEQHLESPVPSAPGALAGGPT
QAAPGVRGEEEQWAREIGAQLRRMADDLNALYERRRQEEQQRHRPSPWRVLYNLIMGLLP
LPRGRGAPEMEPN
NT seq 582 nt   +upstreamnt  +downstreamnt
atggcccgagcacgccaggagggcagctccccggagcccgtagagggcctggcccgcgac
ggcccgcgcccctttcccctcagccgcctggtgccctcggccgtctcctgcggcctctgt
gagccgggcctgccctccgcccccgccgcccccgccctgctgcccgctgcctacctctgc
gcccccaccgccccgcccgccgtcaccgccgccctggggggcccccgctggcctgggggc
ccccgcagccggccccgaggcccgcgccccgacggtcctcagccctcactctcgccggca
gagcagcacctggaatcgccggtgcccagtgccccgggggccctggcgggaggccccacc
caggcagccccgggagtccggggggaggaggagcagtgggcccgggagatcggggcccag
ctgcggcggatggcggacgacctcaacgcgctgtacgagcggcggagacaagaggagcag
cagcgacaccgcccctcaccctggagggtcctgtacaatctcatcatgggactcctgccg
ttacccaggggccgcggagccccggagatggagcccaattag

DBGET integrated database retrieval system