KEGG   Ursus arctos horribilis: 113244914
Entry
113244914         CDS       T05909                                 

Gene name
CSF1
Definition
(RefSeq) macrophage colony-stimulating factor 1
  KO
K05453  macrophage colony-stimulating factor 1
Organism
uah  Ursus arctos horribilis
Pathway
uah04010  MAPK signaling pathway
uah04014  Ras signaling pathway
uah04015  Rap1 signaling pathway
uah04060  Cytokine-cytokine receptor interaction
uah04061  Viral protein interaction with cytokine and cytokine receptor
uah04151  PI3K-Akt signaling pathway
uah04380  Osteoclast differentiation
uah04640  Hematopoietic cell lineage
uah04668  TNF signaling pathway
uah05010  Alzheimer disease
uah05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    113244914 (CSF1)
   04015 Rap1 signaling pathway
    113244914 (CSF1)
   04010 MAPK signaling pathway
    113244914 (CSF1)
   04668 TNF signaling pathway
    113244914 (CSF1)
   04151 PI3K-Akt signaling pathway
    113244914 (CSF1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113244914 (CSF1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    113244914 (CSF1)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    113244914 (CSF1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    113244914 (CSF1)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    113244914 (CSF1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    113244914 (CSF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113244914 (CSF1)
Cytokines and growth factors [BR:uah04052]
 Cytokines
  CSF and other factors
   113244914 (CSF1)
SSDB
Motif
Pfam: CSF-1
Other DBs
NCBI-GeneID: 113244914
NCBI-ProteinID: XP_026340395
UniProt: A0A3Q7UJN6
LinkDB
Position
Unknown
AA seq 559 aa
MTARGAAGRCPPTTWLKPLLLLVCLLASGSITEEVSERCSHMIGNGHLQFLQELIDSQME
TSCQIAYEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFKDNTPNAIVIVKLQELSLRLK
SCFTKDYDEQDKACVRTYYETPLQLLEKIKNVFNETKNLLKKDWNVFSKNCNNSFAKCSS
QDVVTKPDCNCLYPKATPSSDLASVSPQQPLAPSMAPMAGLTWADSEGTEGSSLLPSEQP
LRTVDLDPRSAKQRPPRSTCQSFESPEPPGVEASPVVGDSPQPRPSVGAPVPGMEDILDS
ALGTNWTLEEASGEASEVPVPQGAALSSSRLGGGRVQAETTAGPSDLSSAPFPQSYSARG
EQPEDMTGVPLPTVGPARPTGQAQSHTPEKTDRPSAPPRDHQEPSSARTPSRPPRGLRSP
SALSAQPNLPRRHSWGHVLPLGELEGRRSTRDRRSPTELEGRRASEGAAGAPAPFNSVPL
TDTGHERQQEGPSDPQLRGFTFHLLVPSITLLLLAVGGLLFYRWRRRSHREPQTADSPME
KPEGSPLTQDEDRQVELPV
NT seq 1680 nt   +upstreamnt  +downstreamnt
atgaccgcgcggggcgccgccgggcgctgccctcccacgacatggctgaagcccctgctg
ctgctggtctgtctcctggcgagcgggagcattaccgaggaggtgtcagagcgctgtagc
cacatgattgggaacggacacctgcagttcctccaggagctgatcgatagtcagatggag
acttcctgccagatcgcctatgagtttgtagaccaggaacagctgaaagatcccgtgtgc
tacctgaagaaggcgtttctcctggtacaagacataatggaagacaccatgcgcttcaaa
gacaatactcccaacgccattgttatcgtgaagctccaggaactctctctgaggctgaag
agctgcttcaccaaggactatgacgagcaggacaaggcctgtgtccgaacttactatgag
acacccctgcagttgctggaaaagatcaagaatgtctttaatgaaacaaagaatctcctg
aaaaaggactggaacgttttcagcaagaactgcaacaacagctttgctaagtgctccagc
caagatgtggtgaccaagcctgattgcaactgcctgtaccccaaagccacccctagcagt
gacctggcctctgtctcccctcagcagccccttgccccctccatggcccctatggctggc
ttgacctgggctgactctgaggggacagaaggcagctccctcttgcccagtgagcagccc
ctccgcacagtggacctggacccgcgaagtgccaagcagcgaccacccaggagcacctgc
cagagctttgaatcccctgagcccccaggggtggaggccagccccgtcgtcggagattca
cctcagccccggccctctgtcggggcccccgtccctgggatggaagacattcttgactct
gcattgggcactaactggaccctagaagaggcctccggagaggctagtgaggttcccgta
ccccaaggggcagcgctttcttcctccaggctgggaggaggcagagtccaggccgagacg
accgccgggcccagtgacctctcgtcagcaccttttccacagtcctactcagccaggggc
gagcagccagaggacatgacgggcgtacccctgcccacagtgggccccgcaagacccact
ggccaggcccagagtcacacacctgagaagacagaccgtccatctgccccgcccagagac
caccaggagccaagctctgccaggaccccgtcgcggcccccacgaggcctcaggagtccc
tcagccctctctgcacagccaaaccttcccagaaggcactcctggggccatgtgctgccc
ctcggggagctggagggcagaaggagcaccagggatcgaaggagccccacagagctggaa
ggaagacgagcaagtgagggggcggccggggccccggccccttttaactccgttcctttg
actgacacaggccatgagaggcagcaggagggaccctctgaccctcagctccgcgggttt
accttccacctgctggtgcccagcatcaccctgctcctgctggccgtcggcggcctcctg
ttctacaggtggagacggcggagccaccgagagcctcagacagcggattctcccatggag
aaaccagagggcagccccctgacccaggatgaggacagacaggtggaactgccagtgtag

DBGET integrated database retrieval system