KEGG   Ursus arctos horribilis: 113245310
Entry
113245310         CDS       T05909                                 

Gene name
IL6R
Definition
(RefSeq) interleukin-6 receptor subunit alpha isoform X1
  KO
K05055  interleukin 6 receptor
Organism
uah  Ursus arctos horribilis
Pathway
uah01521  EGFR tyrosine kinase inhibitor resistance
uah04060  Cytokine-cytokine receptor interaction
uah04061  Viral protein interaction with cytokine and cytokine receptor
uah04066  HIF-1 signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04630  Jak-STAT signaling pathway
uah04640  Hematopoietic cell lineage
uah04659  Th17 cell differentiation
uah04932  Non-alcoholic fatty liver disease (NAFLD)
uah05163  Human cytomegalovirus infection
uah05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113245310 (IL6R)
   04066 HIF-1 signaling pathway
    113245310 (IL6R)
   04151 PI3K-Akt signaling pathway
    113245310 (IL6R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113245310 (IL6R)
   04061 Viral protein interaction with cytokine and cytokine receptor
    113245310 (IL6R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    113245310 (IL6R)
   04659 Th17 cell differentiation
    113245310 (IL6R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113245310 (IL6R)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    113245310 (IL6R)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    113245310 (IL6R)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    113245310 (IL6R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:uah04050]
    113245310 (IL6R)
   04090 CD molecules [BR:uah04090]
    113245310 (IL6R)
Cytokine receptors [BR:uah04050]
 Interleukin receptor families
  IL6/12 receptor family
   113245310 (IL6R)
CD molecules [BR:uah04090]
 Proteins
  113245310 (IL6R)
SSDB
Motif
Pfam: IL6Ra-bind Ig_3 Ig_2 ig fn3 I-set Ig_5
Other DBs
NCBI-GeneID: 113245310
NCBI-ProteinID: XP_026341088
UniProt: A0A3Q7UWQ0
LinkDB
Position
Unknown
AA seq 466 aa
MLALRCALLTALLAAPGAALAPGGCPAPEVVSDAVTSLPGASVTLLCPGGEPGDAVHWLL
GNRAAGPHQGSWAAVGRKLLLRSVQLSDSGNYSCYQDGRLLGTVRLLVDAPPEEPQLSCF
RKSPLSKVACEWSPRHPPSPTTRATLLVRKFRSVPLGDSQEPCPYAQGSRKFSCRLAVPE
GDNSLYVVSLCVSNSAGSRSSSPQTFEGYGILQPDPPANITVTAVDGNPRWLSVTWQDPP
SWNSYFYRLQFELRYRAERSKTFTTWMVQELRHRCIIYDAWRGMRHVVQLRAREEFGHGS
WSAWSQEATGTPWTESRSPPAESEVSPSTQALTTNEDDESSLSKSSANATSLPVQDSSPV
PLPTFLVAGGSLAFGTLLCVGIVLRFRRTWKLHALKEGKASVHPPYSLGQLVPERPKPTP
GLVPLISPPVSPSSLGSDSTSRPSRPDARGPQSPYDISNRDYFFPR
NT seq 1401 nt   +upstreamnt  +downstreamnt
atgctggccctgcgctgcgctctgctgacagccctgctggccgcgccgggggccgccctg
gccccagggggctgccccgcgccggaggtggtgagcgatgcagtgaccagcctgcctggg
gccagcgtgaccctgctctgcccgggcggggagccaggagacgccgttcactggctgctg
gggaatcgtgcagcgggcccgcaccagggcagctgggccgctgtgggaaggaagctgctt
ctgaggtccgtgcagctcagcgactctggaaactattcatgttaccaggacggccgcctg
ctcggaaccgtgcgtttgctggtggatgccccccctgaggagccccagctctcctgcttc
cggaagagtcccctcagcaaggtggcctgtgagtggagtcctcggcacccaccgtccccg
acgaccagggccacattactggtgaggaagtttcggagcgtcccgctgggagactcccag
gagccgtgcccgtatgcccaggggtcccggaagttctcctgccggctggcggtcccggag
ggcgacaactccttgtacgtcgtgtccctgtgcgtcagcaacagtgccggaagcaggtcc
agcagtccccagacgtttgagggctacggaatcctgcagcccgacccgcctgccaacatc
accgtcactgctgtggacggaaacccccgctggctcagtgtgacctggcaggaccccccc
tcctggaactcctatttctacaggctgcagtttgagctccgataccgggctgaacggtca
aagacgttcacaacgtggatggtccaggagctccggcaccgctgcatcatctacgacgcc
tggagaggcatgcggcacgtggtgcagcttcgggcgcgggaggagttcggccatggctcc
tggagcgcctggagccaggaggccacgggcaccccttggacagaatccaggagccctcca
gctgagagcgaggtgtccccctccacgcaggcgctgactactaatgaggacgatgaaagt
agtctctctaaaagttctgcaaatgcaaccagcctcccagtgcaagactcttctccagtg
ccactgcccaccttcctggtggccggaggaagcctggccttcgggacgctcctgtgtgtc
ggcatcgtcctgaggttcaggaggacgtggaagctgcatgcactgaaggaaggcaaggcg
agcgtgcacccgccatactcgctgggacagctggtgcccgagagacccaagcccaccccg
gggctggtgcccctcatctccccgccagtgtcccccagcagccttgggtctgacagcacc
tcgaggcccagccggccggatgccaggggcccacagagcccttacgacatcagcaacaga
gactacttcttccccagatag

DBGET integrated database retrieval system