KEGG   Ursus arctos horribilis: 113250835
Entry
113250835         CDS       T05909                                 

Gene name
IFIH1
Definition
(RefSeq) interferon-induced helicase C domain-containing protein 1
  KO
K12647  interferon-induced helicase C domain-containing protein 1 [EC:3.6.4.13]
Organism
uah  Ursus arctos horribilis
Pathway
uah04622  RIG-I-like receptor signaling pathway
uah05161  Hepatitis B
uah05162  Measles
uah05164  Influenza A
uah05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:uah00001]
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    113250835 (IFIH1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    113250835 (IFIH1)
   05164 Influenza A
    113250835 (IFIH1)
   05161 Hepatitis B
    113250835 (IFIH1)
   05168 Herpes simplex virus 1 infection
    113250835 (IFIH1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:uah04054]
    113250835 (IFIH1)
Enzymes [BR:uah01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     113250835 (IFIH1)
Pattern recognition receptors [BR:uah04054]
 Cytoplasmic pattern recognition receptors
  RIG-I-like receptors
   113250835 (IFIH1)
SSDB
Motif
Pfam: RIG-I_C CARD_2 RIG-I_C-RD Helicase_C ResIII DEAD CARD SWI2_SNF2 AAA_19 AAA_22 DUF3638
Other DBs
NCBI-GeneID: 113250835
NCBI-ProteinID: XP_026348460
UniProt: A0A3Q7V8L4
LinkDB
Position
Unknown
AA seq 1017 aa
MSNGYSADQSFCHLISCFRARVKTYIQVEPVLDYLNFLPDDVKEQIQRTAVNAGNMQAAD
QLLSALEKGGWPPGWARQFLVALQRAGSDLAARYLNPELTDLPSPSSETTHDECLQLLTL
LQPTLVDRLLVRDILDRCMEKKLLTNEDRSRISAAESNGNESGVRELLRRIVQKENWFSE
FLTVLRQTENHALVQELTGTTCFESNAEPENLSQRDGPDVQEAVLSATGQPSPEREGWDE
DCDSLESSLVDSSVVSESDTSLAEGSVSCLDESLGHNSNMGSDSDEENVAERASPEPELH
LRPYQMEVAQPALEGKNIIICLPTGSGKTRVAVYIAKDHLDKKKKASEPGKVIVLVNKVP
LVEQLFRKEFEPFLKKWYHTIGLSGDTQLKISFPEVVKTYDVIISTAQILENSLLNSEKG
EDDGVQFSDFSLIVIDECHHTNKEAVYNNIMRRYLKQKLKNNKLKKECKPVIPLPQILGL
TASPGVGGAKKQAEAKEHILKICANLDACTIKTVKENIVQLKDQIKEPCKKFAIADDTRE
DPFKDKLLEIMNKIQSFCQMSPMSDFGTQPYEQWTTQMEKKAAREGNRKERVCAEHLRKY
NEALQINDTIRTIDAYNHLEAFYNDEKEKKFAVLEDDSDESGEDGDGDEDEDDVKKPLSL
DRTDRFLMDLFFENRRMLKKLAENPKHENEKLIKLRNTIMEQYTRTEESARGIIFTKTRQ
SAYALSQWITENKKFAEVGVKAHHLIGAGHSSEFKPMTQNEQKEVISKFRTGKINLLIAT
TVAEEGLDIKECNIVIRYGLVTNEIAMVQARGRARADESTYVLVAHSNSGVIEREIVNDF
REKMMYKAIDHVQNMNPEEYARKILELQMQSIMEKKMKIKRSIAKHYKENPSLINFLCKN
CSVLACSGEDIHVIEKMHHVNMTPVFKELYIVRENKALRKKFADYQTNGEIICKKCGQAW
GTMMVHKGLDLPCLKIKNFVVVFKNNTPKKQYKKWVELPITFPDLDYSQYCLCSDED
NT seq 3054 nt   +upstreamnt  +downstreamnt
atgtcgaacggctattctgcagaccagagtttctgccatctcatctcgtgtttcagggcc
agagtgaaaacgtacatccaggtggagcccgttctcgactacctgaactttctgcccgat
gacgtgaaggagcagattcagaggacggccgtcaacgctgggaacatgcaggcagctgat
caacttctgagcgcgctggagaagggaggctggccccccggctgggctaggcagtttctg
gtggccctgcagagagcaggcagcgatttagccgcccgctacctgaacccagagctcacc
gacttgccgtctccatcctctgagaccactcacgatgagtgtctccaactgctgaccctc
cttcagcccaccctggtggacagacttctggtcagagatatcttggataggtgtatggag
aagaaactgttgacaaatgaagacagaagtcggatttctgctgcagaaagcaatggaaat
gaatcaggtgtaagagagctactgagaaggatcgtgcagaaagaaaactggttttctgaa
tttctgactgttctgaggcaaacagaaaaccacgcccttgtccaagagctaacaggcacc
acttgctttgaaagcaatgcagagcctgagaatttatcacaacgagatggccctgatgtt
caagaagcagttctttcagccacaggtcagccaagtccagagagagagggctgggacgag
gattgtgattccctggaatcgtctttggtggattcttctgttgtttcagaatcagacaca
agtttggcagaaggaagtgtcagctgcttagatgaaagtcttggacataacagcaacatg
ggaagtgattcagatgaagagaatgtggcagaaagagcatcgcctgagccagaactgcat
ctcaggccttaccaaatggaagtcgcccaaccagccttggaggggaaaaatatcattata
tgcctccctacagggagtgggaaaaccagagtggctgtttacattgccaaggatcacttg
gacaagaagaaaaaggcatctgaacctggaaaagttatagtccttgtcaataaggtgcca
ctagttgaacagctcttccgcaaagagtttgaaccatttttgaagaaatggtatcataca
attggattaagtggtgatacccagttgaaaatatcatttccagaagttgtcaaaacctat
gatgttatcatcagtacagcccaaatccttgaaaattctcttttaaattcagaaaaagga
gaagatgatggtgtccagttttcagacttttccctcatcgtcattgatgaatgccatcac
accaacaaagaagcagtctataataacatcatgaggcgttacttgaaacagaagttgaaa
aacaataaactcaagaaagaatgcaaaccggtgattcccctacctcagatactaggacta
acggcttcaccaggtgttggaggagccaaaaagcaagctgaagccaaggaacacatttta
aaaatatgtgccaatcttgatgcatgtaccattaaaactgtaaaagaaaatattgttcaa
ctcaaagaccaaataaaagagccatgcaaaaagtttgcaatcgcagatgacaccagagaa
gatccatttaaagataaacttttagaaataatgaacaagattcaaagtttttgccaaatg
agtccaatgtcagattttggaactcaaccctatgaacaatggaccactcaaatggaaaaa
aaagctgcccgagaaggaaatcgcaaagaacgtgtttgtgcagagcatttgaggaagtac
aatgaagccctacaaattaatgacacaattcgaacgattgatgcatataatcaccttgaa
gctttctataatgatgagaaagaaaagaagtttgcagtcctagaagatgatagtgatgag
agtggtgaggatggtgatggtgatgaagatgaagatgatgtaaagaaacctttgagcctg
gataggacagatagatttctcatggatttatttttcgaaaacaggagaatgttgaaaaag
ctggctgaaaacccaaaacatgaaaatgaaaagctgatcaaattaagaaacaccataatg
gaacaatatacaaggactgaagaatcggcccgaggaataattttcacaaaaacacgacag
agtgcatatgccctttctcagtggattactgaaaataaaaaatttgcagaagtaggagtc
aaagcccatcatctgattggagctggacacagcagtgagttcaagcccatgacgcagaat
gaacaaaaagaagtcattagtaaattccgcacaggaaaaataaatctgcttatcgctacc
acagtggcagaagaaggtctggatattaaagaatgtaatatcgttatccgttatggtctc
gtcactaacgaaatagccatggtccaggcccgtggtcgagccagagctgatgagagcacc
tacgtcctggttgcccacagtaactcaggagttattgaacgcgagatagttaatgatttc
cgagagaaaatgatgtataaagctatagaccatgttcagaatatgaacccagaggagtat
gctcgtaagattttggaattacagatgcaaagtataatggaaaagaaaatgaaaatcaag
agaagtattgcaaagcactacaaggaaaacccatcactaataaatttcctctgcaaaaac
tgcagtgtgctagcctgctctggagaagatatccatgtcattgagaagatgcaccacgtc
aacatgacgccagtattcaaggaactctacattgtgagagaaaacaaagcactacgaaag
aaatttgcagactatcaaacaaatggcgagattatctgcaaaaaatgtggccaagcttgg
gggacgatgatggtgcacaaaggcttagatttgccttgtctcaaaataaagaattttgta
gtggttttcaaaaataatacgccaaagaaacaatacaaaaagtgggtagaattacctatc
acatttcccgatcttgactattcacaatattgtttgtgtagtgatgaggattga

DBGET integrated database retrieval system