KEGG   Ursus arctos horribilis: 113251703
Entry
113251703         CDS       T05909                                 

Gene name
CCL17
Definition
(RefSeq) C-C motif chemokine 17
  KO
K21083  C-C motif chemokine 17
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04061  Viral protein interaction with cytokine and cytokine receptor
uah04062  Chemokine signaling pathway
uah04625  C-type lectin receptor signaling pathway
uah04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113251703 (CCL17)
   04061 Viral protein interaction with cytokine and cytokine receptor
    113251703 (CCL17)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    113251703 (CCL17)
   04657 IL-17 signaling pathway
    113251703 (CCL17)
   04062 Chemokine signaling pathway
    113251703 (CCL17)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113251703 (CCL17)
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Chemokines
   113251703 (CCL17)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 113251703
NCBI-ProteinID: XP_026349471
UniProt: A0A3Q7ULS8
LinkDB
Position
Unknown
AA seq 99 aa
MIPLKMLVLVMLLLGASLQVTHAARGTNVGRECCLEYFKGAIPLRRLKMWYRTSRECPKE
AIVLVTVQDKPICSDPKDMRVKRAIRYLKSMKDPGLQES
NT seq 300 nt   +upstreamnt  +downstreamnt
atgatccccctgaagatgctggtcctggtcatgctccttctgggggcttctctgcaggtc
acgcatgcagcgcgagggaccaatgtgggccgggagtgctgcctagagtacttcaaagga
gccattcctctcagaagactgaaaatgtggtacaggacctcaagggagtgtcccaaggaa
gccatcgtgcttgtaactgtccaggacaagcccatctgttcggaccccaaggacatgagg
gtgaagagggcaatcagatatttaaaaagcatgaaggaccctgggctccaggagtcctga

DBGET integrated database retrieval system