Ursus arctos (brown bear): 113252282 Help Entry 113252282         CDS       T05909                                  Symbol CCL22 Name (RefSeq) C-C motif chemokine 22   KO K21095   C-C motif chemokine 22 Organism uah  Ursus arctos (brown bear) Pathway uah04060   Cytokine-cytokine receptor interaction uah04061   Viral protein interaction with cytokine and cytokine receptor uah04062   Chemokine signaling pathway uah04625   C-type lectin receptor signaling pathway Brite KEGG Orthology (KO) [BR:uah00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     113252282 (CCL22)    04061 Viral protein interaction with cytokine and cytokine receptor     113252282 (CCL22)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     113252282 (CCL22)    04062 Chemokine signaling pathway     113252282 (CCL22)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:uah04052]     113252282 (CCL22) Cytokines and neuropeptides [BR:uah04052]  Cytokines   Chemokines    113252282 (CCL22) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  113252282 NCBI-ProteinID:  XP_026350621 LinkDB All DBs Position Unknown AA seq 93 aa AA seqDB search MASLKTPLLAALVFLALILQATEAGPYGANVEDSICCRDYFRHPLPLRMLKFFYWTSDSC RRPGVVFLTVKDREICADPRMPWVKKILQKLDQ NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggccagcctgaagactccgctcctggctgcccttgtcttccttgctctgatacttcaa gcaactgaggcaggtccttacggcgccaacgtggaggacagcatctgctgccgggactac ttccgtcaccctctgcccctgcgcatgctgaagtttttctactggacctcggactcgtgc cggcggcccggcgtggtcttcctaactgtcaaggaccgggagatctgtgctgaccccaga atgccctgggtgaagaagattctccagaaactggaccaatga

DBGET integrated database retrieval system