KEGG   Ursus arctos horribilis: 113255825Help
Entry
113255825         CDS       T05909                                 

Gene name
CPE
Definition
(RefSeq) carboxypeptidase E isoform X1
  KO
K01294  carboxypeptidase E [EC:3.4.17.10]
Organism
uah  Ursus arctos horribilis
Pathway
uah04940  Type I diabetes mellitus
Brite
KEGG Orthology (KO) [BR:uah00001]
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    113255825 (CPE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:uah01002]
    113255825 (CPE)
Enzymes [BR:uah01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.10  carboxypeptidase E
     113255825 (CPE)
Peptidases and inhibitors [BR:uah01002]
 Metallo peptidases
  Family M14: carboxypeptidase A family
   113255825 (CPE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M14 CarboxypepD_reg CarbopepD_reg_2 AstE_AspA
Motif
Other DBs
NCBI-GeneID: 113255825
NCBI-ProteinID: XP_026355385
UniProt: A0A3Q7VSX6
LinkDB All DBs
Position
Unknown
AA seq 496 aa AA seqDB search
MAARGGRALLALCGALAACGWLLGAGAQEPGAPAAGMRRRRRLQQEDGISFEYHRYPELR
EALVSVWLQCTAISRIYTVGRSFEGRELLVIELSDNPGVHEPGEPEFKYIGNMHGNEAVG
RELLIFLAQYLCNEYQKGNETIVNLIHNTRIHIMPSLNPDGFEKAASQPGELKDWFVGRS
NAQGIDLNRNFPDLDRIVYVNEKEGGPNNHLLKNLKKIVDQNTKLAPETKAVIHWIMDIP
FVLSANLHGGDLVANYPYDETRSGSAHEYSSCPDDAIFQSLARAYSSFNPPMSDPNRPPC
RKNDDDSSFIDGTTNGAAWYSVPGDHQQLCNTLYPGRRMKCKDTGMQDFNYLSSNCFEIT
VELSCEKFPPEETLKSYWEDNKNSLISYLEQIHRGVKGFVRDLQGNPIANATISVEGIDH
DVTSAKDGDYWRLLVPGNYKLTASAPGYLAITKKVAVPYSPAVGVDFELESFSERKEEEK
EELMEWWKMMSETLNF
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgcgaggaggccgggcgctgctggcgctgtgcggggcgctggccgcctgcggg
tggctgctgggcgccggagcccaggagcccggggcgcccgcggcgggcatgaggcggcgc
cggcggctgcagcaggaggacggcatctccttcgagtaccaccgttaccccgagctgcgc
gaggcgctggtgtccgtgtggctgcagtgcaccgccatcagcaggatctacacggtgggg
cgcagcttcgagggccgggagctcctggtcatcgagctgtccgacaaccccggtgtccac
gagcctggtgagcctgaatttaaatacattgggaatatgcacggtaatgaggctgttgga
cgggaactgctcattttcctggcccaatacttgtgcaacgaataccaaaaggggaacgag
acgatcgttaacctaatccacaacactcggatccacatcatgccttccctcaacccggac
ggctttgagaaggctgcatctcagcccggtgagctcaaggactggtttgtgggtagaagc
aatgcccagggaatagatctgaaccggaactttccagacctggataggatagtttatgtt
aatgagaaagaaggtggtccaaataatcatctgttgaaaaatctgaagaagattgtggat
caaaacacaaagcttgctcccgagaccaaggcagtcatccattggatcatggatattcct
ttcgtgctctctgccaatctccacggaggagaccttgtggccaattacccatatgacgag
acgcggagtggtagtgctcatgaatatagctcctgcccagatgatgccattttccaaagc
ttagctcgggcgtactcctcttttaacccacccatgtctgaccccaatcggcctccgtgt
cgcaagaatgatgacgacagcagcttcatagatggaacaaccaatggtgctgcttggtac
agtgtacccggcgaccaccaacagttgtgtaacactctctacccaggacgaagaatgaaa
tgtaaagatactggaatgcaagacttcaattacctcagcagcaactgtttcgagatcacc
gtggagcttagctgtgaaaagtttccacctgaagagactctgaagagctactgggaggat
aacaaaaactcccttattagctacctcgagcagatacaccgaggagttaaaggctttgtc
cgagaccttcaggggaacccaattgccaatgcgaccatctccgtggaaggaatagaccac
gatgttacatctgcaaaggatggtgattactggagattgcttgtacctggaaactataaa
ctcacagcctcggctccaggctatctggcaataacaaagaaagtagcagttccttatagc
cctgctgttggggttgattttgaactggagtcattttctgaaaggaaagaagaggaaaag
gaagaattgatggaatggtggaaaatgatgtcagaaaccttaaatttttaa

DBGET integrated database retrieval system