KEGG   Ursus arctos horribilis: 113256194
Entry
113256194         CDS       T05909                                 

Gene name
KITLG
Definition
(RefSeq) kit ligand isoform X1
  KO
K05461  KIT ligand
Organism
uah  Ursus arctos horribilis
Pathway
uah04010  MAPK signaling pathway
uah04014  Ras signaling pathway
uah04015  Rap1 signaling pathway
uah04072  Phospholipase D signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04640  Hematopoietic cell lineage
uah04916  Melanogenesis
uah05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113256194 (KITLG)
   04014 Ras signaling pathway
    113256194 (KITLG)
   04015 Rap1 signaling pathway
    113256194 (KITLG)
   04072 Phospholipase D signaling pathway
    113256194 (KITLG)
   04151 PI3K-Akt signaling pathway
    113256194 (KITLG)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    113256194 (KITLG)
  09152 Endocrine system
   04916 Melanogenesis
    113256194 (KITLG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113256194 (KITLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113256194 (KITLG)
Cytokines and growth factors [BR:uah04052]
 Growth factors
  Growth factors (RTK binding)
   113256194 (KITLG)
SSDB
Motif
Pfam: SCF Psg1
Other DBs
NCBI-GeneID: 113256194
NCBI-ProteinID: XP_026355716
UniProt: A0A3Q7V349
LinkDB
Position
Unknown
AA seq 274 aa
MKKTQTWIITCIYLQLLLFNPLVKTKGICRNRVTDDVKDVTKLVANLPKDYKIALKYVPG
MDVLPSHCWISVMVEQLSVSLTDLLDKFSNISEGLSNYSIIDKLVKIVDDLVECMEEHSF
ENVKKSPKSPELRHFTPEEFFRIFNRSIDALKDLETVASKSSECVVSSTLSPEKDSRVSV
TKPFMLPPVAASSLRNDSSSSNRKASNPIGDSSLQWAAMALPAFFSLVIGFAFGALYWKK
KQPNLTRTVENIQINEEDNEISMLQEKEREFQEV
NT seq 825 nt   +upstreamnt  +downstreamnt
atgaagaagacacaaacttggattatcacttgcatttatcttcaactactcctatttaat
cctctggtcaaaactaaagggatctgcaggaaccgtgtgactgatgatgtgaaagacgtt
acaaaattggtggcaaatcttccaaaagactataagatagccctcaaatatgtccccggg
atggatgttttgcctagtcattgttggataagcgtgatggtggaacagttgtcagtcagc
ttaactgatcttctggacaaattttcaaatatttctgaaggcttgagtaattactctatc
atagacaaacttgtgaaaatagtggatgaccttgtggagtgcatggaagaacactcattt
gagaatgtaaaaaaatcacctaaaagcccagaactcaggcattttacccctgaagaattc
ttcagaatttttaatagatccattgatgccctcaaggacttggagacggtggcatctaaa
agtagtgaatgtgtggtctcttcaacattaagtcctgaaaaagattccagagtcagtgtc
acaaaaccatttatgttaccccctgttgcagccagctcccttaggaatgacagcagtagc
agtaataggaaggcctcaaaccccattggagactccagcttacaatgggcagccatggca
ttgccagcattcttctctcttgtaattgggtttgcttttggagccttatactggaagaag
aaacaaccaaatctcacaaggacagttgaaaatatacagattaatgaagaggataatgaa
ataagtatgttgcaagaaaaagagagagagtttcaagaggtgtaa

DBGET integrated database retrieval system