KEGG   Ursus arctos horribilis: 113256787
Entry
113256787         CDS       T05909                                 

Definition
(RefSeq) C-C chemokine receptor type 3 isoform X1
  KO
K04178  C-C chemokine receptor type 3
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04061  Viral protein interaction with cytokine and cytokine receptor
uah04062  Chemokine signaling pathway
uah05163  Human cytomegalovirus infection
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113256787
   04061 Viral protein interaction with cytokine and cytokine receptor
    113256787
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    113256787
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    113256787
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    113256787
   05167 Kaposi sarcoma-associated herpesvirus infection
    113256787
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:uah04030]
    113256787
   04050 Cytokine receptors [BR:uah04050]
    113256787
   04090 CD molecules [BR:uah04090]
    113256787
G protein-coupled receptors [BR:uah04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    113256787
Cytokine receptors [BR:uah04050]
 Chemokine receptors
  CC Chemokine
   113256787
CD molecules [BR:uah04090]
 Proteins
  113256787
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srw
Other DBs
NCBI-GeneID: 113256787
NCBI-ProteinID: XP_026356441
UniProt: A0A3Q7V5A5
LinkDB
Position
Unknown
AA seq 387 aa
MVSSFHEWPDLSCHCMHNGLCRSSRDKIMEAFTAVMKTMDESTETTVFDYEDSLPCEKVN
IRQLGSQFLPPLYSLVFVVGLLGNAVVVLILTKYKRLQIMTNIFLLNLAISDLLFLFTLV
FWIHYAGWNEWVFGAFMCKLLSGLYYVGLYSEIFFIILLTVDRYLAIVHAVFALRARTVT
FGVITSVLTWGLAGLAALPEFIFHKSQDEGQHFVCLPLYPKDQEDKWKRFHALRMNILGL
ALPLLIMGVCYSGIIKTLLRCPSKKKYKAIRLIFVIMVVFFIFWTPYNLVLLLSAFQTIF
FEASCEQSKQLDVAMQVTEVIAYTHCCVNPIIYAFVGERFRNHLCHFFRRHVATYLGKYI
PFLPSEKSDRASSPSPSTGEQELSFVF
NT seq 1164 nt   +upstreamnt  +downstreamnt
atggtatcttcgtttcatgagtggccagacctcagctgtcactgcatgcacaacggactt
tgccgaagtagcagggacaaaataatggaggccttcacggcagtgatgaagaccatggac
gagtctacggagaccacggttttcgactacgaggactcgctgccatgtgagaaagtcaac
atcaggcagctgggatcccagttcttgcccccgctgtactccctggtgttcgtggtcggg
ctgctgggcaacgctgtggtagttctgatactcacgaaatacaagaggctccagattatg
accaacatcttcctgctcaacttggctatttcggacttgctctttctattcaccctggtg
ttctggattcattacgctgggtggaatgagtgggtttttggcgctttcatgtgtaagctc
ctctctgggctttattacgtgggcttatacagcgagatctttttcatcatcctgctgacc
gtagacaggtacctggccatcgtccacgccgtgtttgcccttcgagcccggactgtcact
tttggtgtcatcacgagtgtcctcacctggggcctggcagggctagcagccctccctgag
tttatcttccataagtcccaagacgagggccaacattttgtctgcttgcctctttaccca
aaagaccaagaagacaaatggaagcgtttccatgctctgagaatgaatatcctgggtctt
gctctgcctctgcttatcatgggtgtctgctactctggaattattaaaacgctgctgaga
tgccccagtaagaaaaagtacaaggccatccggctcatttttgtcatcatggtggtcttt
ttcattttctggacaccctataacctggtcctccttctctctgcttttcaaacgatcttc
tttgaggccagttgtgagcagagcaaacagctggacgtggccatgcaggtgacggaggtg
atcgcctacacgcactgctgcgtcaaccccatcatctacgccttcgtcggggagaggttc
cggaatcatctctgccactttttccgcaggcacgtggccacctacctgggcaaatacatc
cccttccttcccagcgagaagtcagacagagcaagctctccatccccatcaacaggggag
caggaattgtcatttgtattttaa

DBGET integrated database retrieval system