KEGG   Ursus arctos horribilis: 113257904
Entry
113257904         CDS       T05909                                 

Gene name
CLEC1B
Definition
(RefSeq) C-type lectin domain family 1 member B isoform X1
  KO
K10070  C-type lectin domain family 1 member B
Organism
uah  Ursus arctos horribilis
Pathway
uah04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:uah00001]
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    113257904 (CLEC1B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:uah04054]
    113257904 (CLEC1B)
   04091 Lectins [BR:uah04091]
    113257904 (CLEC1B)
Pattern recognition receptors [BR:uah04054]
 Membrane-bound pattern recognition receptors
  C-type lectin receptors
   113257904 (CLEC1B)
Lectins [BR:uah04091]
 C-Type lectins
  Gropu 5: NK-cell receptors
   113257904 (CLEC1B)
SSDB
Motif
Pfam: Lectin_C UL45 HU-CCDC81_euk_1
Other DBs
NCBI-GeneID: 113257904
NCBI-ProteinID: XP_026358253
UniProt: A0A3Q7W9V8
LinkDB
Position
Unknown
AA seq 228 aa
MLDEDGYITLNVKNRKPALTSVDPASSPLWRVTALILLILCTGLVVGLVALGVMSVTEQN
YQQVENKNASGTLHQLAKKFCQYLIKQLEQKNIVSHKCSPCDRNWRYYGDSCYGFFRRNL
TWEESKQFCISMNSTLLKIASQSVLEYMKSRTGLIRWVGLSRKNPNEIWMWEDGSVPSKN
VFELSGNERENMNCAYFYDGKIYPTFCKNKHHLTCERKAGMVNVDTLL
NT seq 687 nt   +upstreamnt  +downstreamnt
atgctggacgaagatggatatatcaccttaaatgttaaaaatcgaaagccagctctcacc
tcagttgaccctgcttcctcgcctctgtggcgtgtgacggctttgattctgctgatcttg
tgcacgggcttagttgttgggctggtggctctgggggtcatgtccgtcacagagcaaaac
taccaacaagtagagaataaaaatgcctcaggaactctgcaccaattggcaaagaagttc
tgccaatatttaataaaacagttggaacaaaagaacattgtcagccataaatgcagccca
tgtgacagaaattggagatattatggcgatagttgctatggattcttcaggcgcaacttg
acgtgggaagagagcaagcagttctgtattagcatgaactctactttgctgaagatcgcc
agccagagcgttctggaatacatgaagtccaggactggattaattcgttgggttggattg
tcacgcaagaaccctaatgagatctggatgtgggaagatggctccgtgccctccaaaaat
gtgtttgagctttctggaaatgaaagagaaaatatgaattgtgcttatttttatgatggg
aaaatttaccctactttctgtaagaacaagcatcatttgacctgtgagaggaaggcaggc
atggtaaatgtggacacactactttaa

DBGET integrated database retrieval system