KEGG   Ursus arctos horribilis: 113259984
Entry
113259984         CDS       T05909                                 

Gene name
CXCR5
Definition
(RefSeq) C-X-C chemokine receptor type 5
  KO
K04190  C-X-C chemokine receptor type 5
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04061  Viral protein interaction with cytokine and cytokine receptor
uah04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113259984 (CXCR5)
   04061 Viral protein interaction with cytokine and cytokine receptor
    113259984 (CXCR5)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    113259984 (CXCR5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:uah04030]
    113259984 (CXCR5)
   04050 Cytokine receptors [BR:uah04050]
    113259984 (CXCR5)
   04090 CD molecules [BR:uah04090]
    113259984 (CXCR5)
G protein-coupled receptors [BR:uah04030]
 Rhodopsin family
  Chemokine
   CXC Chemokine
    113259984 (CXCR5)
Cytokine receptors [BR:uah04050]
 Chemokine receptors
  CXC Chemokine
   113259984 (CXCR5)
CD molecules [BR:uah04090]
 Proteins
  113259984 (CXCR5)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx DUF4059
Other DBs
NCBI-GeneID: 113259984
NCBI-ProteinID: XP_026361402
UniProt: A0A3Q7XFR4
LinkDB
Position
Unknown
AA seq 374 aa
MNYPLTLDMDLLNYNLEDVYRELGNYSDITESPTVENHLCSTVEGPLLTSFKAVFMPVAY
GFIFLLGMMGNILVLVILERHRHTRSSTETFLFHLAVADLLLVFILPFAVVEGSVGWLLG
TFLCKTVIALHKINFYCSSLLLACIAVDRYLAIVHAVHAYRHRRLLSIHITCATIWLAGC
CFALPEILFAKVSQPHHNDSLPRCTFSQENRAETNAWFTSRFLYHVGGFLLPMLVMGWCY
VGVVHRLCQAQRRPQRQKAVRVAILVTSVFFLCWSPYHIVIFLDTLARLKTVGYSCELNG
YLSVAITMSEFLGLAHCCLNPMLYTFAGVKFRSDLSRLLTKLGCAGPASLCQLFPTWRKS
SLSESENATSLTTF
NT seq 1125 nt   +upstreamnt  +downstreamnt
atgaactaccccctaaccctggacatggatcttctgaactacaacctggaggacgtgtac
agggaactgggcaactacagcgacatcaccgagagccccacggtggaaaatcacctctgc
tccacggtcgaggggcccctcctgacatccttcaaggccgtgttcatgccggtggcctac
ggcttcatcttcctcctcggcatgatgggcaacatcctggtgctggtgatcctggagcgg
caccggcacacgcgcagctccaccgagaccttcctgttccacctggcggtggccgacctc
ctgctggtcttcatcctgcctttcgccgtggtcgagggctctgtgggctggctcctgggc
accttcctctgcaaaactgtgatcgctctgcacaagatcaacttctactgcagcagtctg
ctgctggcctgcatcgccgtggaccgctacctggccatcgtccatgccgtccacgcctac
cgccaccgccgcctcctctccatccacatcacctgtgccaccatctggctggcaggctgc
tgcttcgccctgccggagatcctcttcgccaaagtcagccaaccccatcacaacgactcc
ctgccacgctgtaccttctcccaggagaaccgggcagagaccaacgcctggttcacctcc
cgcttcctctaccacgtcggaggattcctgctgccgatgctggtgatgggctggtgctat
gtcggggtggtgcacaggctgtgccaggcccagcggcgccctcagaggcagaaggcagtc
agggtggccatcctggtgacgagcgtcttctttctctgttggtcaccctaccacatcgtc
atcttcctggacaccctggcgaggctgaagaccgtgggctatagctgtgagctgaatggc
tacctctccgtggccatcaccatgagtgagttcctgggcctggcccactgctgtctcaat
cccatgctctacactttcgcaggcgtgaagttccggagcgacctgtcgcgccttctgacc
aagctgggctgtgccggccctgcctccctttgccagttattccctacgtggcgcaagagc
agtctctctgagtccgagaatgccacctccctcaccaccttctag

DBGET integrated database retrieval system