KEGG   Ursus arctos horribilis: 113262884
Entry
113262884         CDS       T05909                                 

Gene name
CD247
Definition
(RefSeq) T-cell surface glycoprotein CD3 zeta chain isoform X1
  KO
K06453  CD3Z antigen, zeta polypeptide
Organism
uah  Ursus arctos horribilis
Pathway
uah04650  Natural killer cell mediated cytotoxicity
uah04658  Th1 and Th2 cell differentiation
uah04659  Th17 cell differentiation
uah04660  T cell receptor signaling pathway
uah05142  Chagas disease (American trypanosomiasis)
uah05169  Epstein-Barr virus infection
uah05170  Human immunodeficiency virus 1 infection
uah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    113262884 (CD247)
   04660 T cell receptor signaling pathway
    113262884 (CD247)
   04658 Th1 and Th2 cell differentiation
    113262884 (CD247)
   04659 Th17 cell differentiation
    113262884 (CD247)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    113262884 (CD247)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    113262884 (CD247)
   05169 Epstein-Barr virus infection
    113262884 (CD247)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    113262884 (CD247)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:uah04147]
    113262884 (CD247)
   04090 CD molecules [BR:uah04090]
    113262884 (CD247)
Exosome [BR:uah04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   113262884 (CD247)
CD molecules [BR:uah04090]
 Proteins
  113262884 (CD247)
SSDB
Motif
Pfam: ITAM TCR_zetazeta P53_tetramer
Other DBs
NCBI-GeneID: 113262884
NCBI-ProteinID: XP_026365241
UniProt: A0A3Q7VVZ0
LinkDB
Position
Unknown
AA seq 183 aa
MAATASASWHHPGGKDKMTWKVLVIMALLQAQLPVTGAQSYGLVDPKLCYLLDVLLLIYG
VIITALFLRAKFGRSAASPEDQQGPNQLYNELNLRGREEYEVLDKRRGLDPEMGGKQQRK
RNPHEVVYNALQKDKMAEAYSEIGIKGENQRRRGKGHDGLYQGLSTATKDTYDALHMQTL
PPR
NT seq 552 nt   +upstreamnt  +downstreamnt
atggctgccacagcctcggcgtcctggcaccatcctgggggaaaggacaagatgacgtgg
aaggtgctggttatcatggccttgctgcaggcacagctcccagttacaggggcacagagc
tatggcctggtggatcccaaactgtgctacctgctggacgtactcctcctcatctatggc
gtcatcatcacggccctgttcctgagagcaaagttcggcaggagcgcggcctcccccgag
gaccagcagggccccaaccagctgtacaacgagctcaatctaagaggaagagaggaatat
gaggttttggataagagacgaggcctggaccctgagatgggaggaaagcagcagaggaag
aggaatcctcatgaagtcgtgtacaacgcactgcagaaagacaagatggcggaggcctac
agtgagattgggataaaaggcgagaaccagcgtcggagagggaaggggcacgatggtctt
taccaggggctcagcacggccaccaaggacacctatgatgccctccacatgcagaccctg
cctcctcgctaa

DBGET integrated database retrieval system