KEGG   Ursus arctos horribilis: 113262895
Entry
113262895         CDS       T05909                                 

Gene name
TLR5
Definition
(RefSeq) toll-like receptor 5 isoform X1
  KO
K10168  toll-like receptor 5
Organism
uah  Ursus arctos horribilis
Pathway
uah04620  Toll-like receptor signaling pathway
uah05132  Salmonella infection
uah05134  Legionellosis
uah05321  Inflammatory bowel disease (IBD)
Brite
KEGG Orthology (KO) [BR:uah00001]
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    113262895 (TLR5)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    113262895 (TLR5)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    113262895 (TLR5)
   05134 Legionellosis
    113262895 (TLR5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:uah04054]
    113262895 (TLR5)
Pattern recognition receptors [BR:uah04054]
 Membrane-bound pattern recognition receptors
  Toll-like receptors
   113262895 (TLR5)
SSDB
Motif
Pfam: LRR_8 TIR LRR_4 TIR_2 LRR_5 LRR_1 LRRCT
Other DBs
NCBI-GeneID: 113262895
NCBI-ProteinID: XP_026365260
UniProt: A0A3Q7XQQ8
LinkDB
Position
Unknown
AA seq 883 aa
MRPGHERQDPSPAGAGLGTQARRRIMGGHLDLLFGVIIAASPVLAMPSCASDGQRALYRS
CNLTQVPPVPSTTQVLLLSFNYIRTVTATSFPFLEQLQLLELGTQFTPFTIGREAFRNLP
NLRVLDLGNSQVDFLHPDAFQGLPHLLELRLFYCGLSDTILKDGYFRNLESLSRLDLSKN
EIRSLKLHPSFWELNSLKSIDFSLNQIAIVCEQELQPLQGKTLSLFNLAANHLYSRVSVD
WGACMNPFTDMVLETLDVSGNGWTADITGNFSRAISGSRISSLVLAHHIMGPGFGFQNIR
DPDRDTFAGLAGSAVLQLDLSHGFIFSLNFRLFEALKALKLLNLAHNKINRIAGEAFYGL
DSLQVLNMSYNLLGELYNSDFYGLPQVAYIDLQNNHIGIIQDQTFRFLKTLHTLDLRDNA
LKTISFLPSIDTIFLSSNKLVTLPNMRLKANFIHLSENRLEDLDDLYFLLQVPDLQVLIL
NQNRFSSCSRAHGPTGSRSLEKLFLGGNMLQLAWETGFCWDVFKGLSRLQILYLNNNYLT
FLPPGALSDLTALRGLDLNSNRLTALAPGDLPANLEVLDVSRNQLLSLDPDLFASLRAVD
ITHNRFICECDLRPLITWLNQTNVTVLGSRADIYCMYPNELTGTPLSSVSMEGCDEEEVL
KVIKFSLFISSTVTLTLFLVTILVVTKLRGLCFICYRAAHRLLPTVYAERCESDTYKYDA
YLCFSGRDFEWVQRALLRHLDAQYSDQNRFNLCFEERDFVPGREHIANIQDAVWGSRKVV
CLVSRHFLRDGWCLEAFTYAQNRCVSDLDGALILVIVGSLSQYELMKHQCIRGFVRKRQY
LRWPEDLQDVGWFLHTLSQHILKKGKDAKRDGSIPLQTVAAIS
NT seq 2652 nt   +upstreamnt  +downstreamnt
atgcgccccggacacgagaggcaggacccctcaccagcaggtgcagggctggggacacaa
gccagacgcaggatcatgggaggccacctggaccttctgttcggggtgattattgcggcc
agccctgtgcttgcgatgccttcctgcgcctctgacggtcagagggccttgtatcgctcc
tgcaacctcacccaggtgccgccggtccccagcaccacccaggtcctcctgctcagcttc
aactatatccggactgtcacggccacgtccttccccttcctggagcagctgcagctgctg
gagctcgggactcagtttacccccttcaccatcggcagagaagccttcagaaacctgccc
aacctgagggtcttggacctgggcaatagtcaggtggatttcctgcatcccgatgctttt
caggggctgccccacctgcttgaactaagactcttctactgtggtctgtctgatactata
ttaaaagatggttatttcagaaacttagagtctttgtctcgcctggacctgtccaaaaat
gagattcgtagccttaagcttcatccttcgttctgggaattgaattccctgaagtccatt
gatttttccctcaaccagatcgccatcgtgtgtgaacaggagctccagccgctccaaggg
aagaccctctccctgttcaacctcgctgccaatcacctgtacagtagggtctccgtggac
tggggcgcgtgcatgaacccgttcacagacatggtcctggaaaccctggacgtttctggc
aatggctggacggcggacatcacagggaacttcagcagggccatcagcgggagccggatc
tcctcgctggttctggcccaccacatcatggggcccgggtttggcttccagaacatcagg
gaccccgaccgggacacgtttgccggcctggccgggagcgcggtgctgcagctggatctg
tcccatggctttatcttctccctgaacttccgactctttgaggccctcaaggccttgaag
ctcctgaacctggcccacaacaagataaacaggattgcaggagaagcattttatggcctt
gacagcctccaggttcttaacatgtcatataaccttctgggggagctttacaattccgat
ttctatggactccctcaggtagcctatattgatcttcaaaacaatcatattgggatcatt
caggaccagaccttcaggttcctgaaaacattacacaccttggatctccgggacaatgct
cttaaaacaatttctttcctgccaagcatagacactatcttcttgagtagcaataaactg
gtgaccttgccgaacatgagacttaaagccaacttcatccacttatcagagaacaggcta
gaagatctggacgatctctacttcctcctccaggtccctgacctccaggtcctcattctg
aatcaaaatcgcttttcctcttgcagccgagctcacggccctacaggcagccgcagctta
gaaaagcttttccttggaggaaacatgttgcagcttgcctgggaaaccggcttctgctgg
gatgtgttcaaggggctctcccggctccagatcctttacctgaacaacaactacttgacc
ttcctcccgccgggggcacttagtgatctgactgcgctgaggggcctcgacctcaactcc
aacaggctgacagctcttgctcctggtgacttgcctgcgaacctggaggtgctggacgtg
tccagaaaccagctcctgtccctggaccccgacttgtttgcatccctcagagccgtggac
ataacgcacaacaggttcatctgtgagtgtgacctccgtcctctcatcacttggctcaac
cagaccaacgtcactgtacttgggtctcgtgcagacatctactgcatgtaccccaacgag
ctcacggggacccccctctcctctgtgtccatggagggctgcgatgaggaggaggtcttg
aaggtcataaagttttcccttttcatctcatccacggtcactctgactctgttcctcgtg
accatccttgtggtcaccaagctccggggcctttgtttcatctgttacagggcggcccac
agactgctgcccacggtctacgctgagcgctgcgagtccgacacgtacaaatacgatgcc
tacctgtgcttcagcggcagagacttcgagtgggtgcagagggctctgctcagacacctg
gatgctcagtacagcgaccagaacagattcaacctgtgctttgaagaaagagacttcgta
ccggggcgggagcacatcgccaacatccaggatgccgtgtggggcagcaggaaggtggtc
tgcctcgtgagcagacacttcctccgagacggctggtgcctggaagccttcacttacgcc
cagaacaggtgcgtgtctgacctggacggcgccctcatcctggtgatcgtcgggtcccta
tcccagtatgagctgatgaagcatcagtgcatcagagggttcgtgcggaaacgacagtac
ttgaggtggcccgaggatctccaggatgttggctggttccttcacacactctctcagcac
attctgaagaaagggaaggacgccaagagggacggtagcatcccattgcaaactgtggcg
gccatctcctag

DBGET integrated database retrieval system