KEGG   Ursus arctos horribilis: 113263254
Entry
113263254         CDS       T05909                                 

Gene name
CXCL10
Definition
(RefSeq) C-X-C motif chemokine 10
  KO
K12671  C-X-C motif chemokine 10
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04061  Viral protein interaction with cytokine and cytokine receptor
uah04062  Chemokine signaling pathway
uah04620  Toll-like receptor signaling pathway
uah04622  RIG-I-like receptor signaling pathway
uah04623  Cytosolic DNA-sensing pathway
uah04657  IL-17 signaling pathway
uah04668  TNF signaling pathway
uah05160  Hepatitis C
uah05164  Influenza A
uah05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    113263254 (CXCL10)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113263254 (CXCL10)
   04061 Viral protein interaction with cytokine and cytokine receptor
    113263254 (CXCL10)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    113263254 (CXCL10)
   04622 RIG-I-like receptor signaling pathway
    113263254 (CXCL10)
   04623 Cytosolic DNA-sensing pathway
    113263254 (CXCL10)
   04657 IL-17 signaling pathway
    113263254 (CXCL10)
   04062 Chemokine signaling pathway
    113263254 (CXCL10)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    113263254 (CXCL10)
   05160 Hepatitis C
    113263254 (CXCL10)
   05169 Epstein-Barr virus infection
    113263254 (CXCL10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113263254 (CXCL10)
   00536 Glycosaminoglycan binding proteins [BR:uah00536]
    113263254 (CXCL10)
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Chemokines
   113263254 (CXCL10)
Glycosaminoglycan binding proteins [BR:uah00536]
 Heparan sulfate / Haparin
  Chemokines
   113263254 (CXCL10)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 113263254
NCBI-ProteinID: XP_026365721
UniProt: A0A3Q7VXI1
LinkDB
Position
Unknown
AA seq 98 aa
MNQSAVLIFCLIFLTLNATQGIPLSRTTRCTCIKISDGSVNPKSLEKLEVIPASQSCPRV
EIIATMKKNGEKRCLNPESKKIKILLKAISKERSKTSP
NT seq 297 nt   +upstreamnt  +downstreamnt
atgaaccaaagtgctgttcttattttctgccttatctttctgactctgaatgcaactcaa
ggaatacctctctctagaactacacgctgcacctgtattaagattagtgatggatctgta
aatccgaagtccttagaaaaacttgaagtgattcctgcaagtcaatcttgtccacgtgtt
gagatcattgccacaatgaaaaagaatggagagaaaagatgtctgaatccagagtctaag
aaaatcaagattttactgaaagcaattagcaaagaaaggtctaaaacatctccttga

DBGET integrated database retrieval system