KEGG   Ursus arctos horribilis: 113265921
Entry
113265921         CDS       T05909                                 

Gene name
WAS
Definition
(RefSeq) wiskott-Aldrich syndrome protein
  KO
K05747  Wiskott-Aldrich syndrome protein
Organism
uah  Ursus arctos horribilis
Pathway
uah04062  Chemokine signaling pathway
uah04520  Adherens junction
uah04530  Tight junction
uah04666  Fc gamma R-mediated phagocytosis
uah05135  Yersinia infection
uah05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    113265921 (WAS)
   04530 Tight junction
    113265921 (WAS)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    113265921 (WAS)
   04062 Chemokine signaling pathway
    113265921 (WAS)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    113265921 (WAS)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    113265921 (WAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:uah04131]
    113265921 (WAS)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:uah04812]
    113265921 (WAS)
Membrane trafficking [BR:uah04131]
 Others
  Actin-binding proteins
   Nucleation-promoting factors (NPFs)
    113265921 (WAS)
Cytoskeleton proteins [BR:uah04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    WASP / WAVE
     113265921 (WAS)
SSDB
Motif
Pfam: WH1 PBD WH2
Other DBs
NCBI-GeneID: 113265921
NCBI-ProteinID: XP_026369152
UniProt: A0A3Q7XZM6
LinkDB
Position
Unknown
AA seq 501 aa
MSGGPVGGRSGGRGGPGVQQNIPSTLLQDHENQRLFEMLGRKCWTLATAVVQLYLALPPG
AEHWTKEHCGAVCFVKDNPQKSYFIRLYSLQTGRLLWEQELYSQLVYSTPTPFFHTFAGD
ACQAGLNFADEGEAQAFRALVQEKIQKRNQRQSGDRRQLPAPPAPANEERRGGLPPLPPH
PGGDQGGLASGQLSLGLVTVDIQNPDITSSRYRGLPAPGPGPADKKRSGKKKISKADIGA
PSGFKHVSHVGWDPQNGFDVNNLDPDLRSLFSRAGISEAQLTDAETSKLIYDFIEDQGGL
EAVRQEMRRQEPLPPPPPPSRGGNQAPRPPTVGSSKGRSGPLPPVPLGGAPPPPTPRGPP
PPGRGGPPPPPPPATGRSGPLPPPPPGAGGPPVPPPPPPPPPPPSSGDGPIPPPPPALGP
TGGLAPGGGRGALLDQIRQGIQLNKTPGAPESSALQPPPQSSEGLVGALMHVMQKRSKAI
HSSDEGEDQAGDEDEDDEWDD
NT seq 1506 nt   +upstreamnt  +downstreamnt
atgagtgggggccctgtgggaggcaggtctgggggtcgcggaggaccaggggttcagcag
aacataccctccacactcctccaggaccacgagaaccagcgactcttcgagatgctgggt
cggaaatgctggacattggccactgccgttgttcagctgtacctggcactgcctcctgga
gctgagcactggaccaaggagcattgtggggctgtgtgcttcgtgaaggataacccccag
aagtcctacttcatccgtctttacagccttcagactggtcggctgctctgggaacaggag
ttgtactcacagttggtctactccactcccacccccttcttccacacctttgctggagat
gcctgccaagcagggctgaactttgcagacgagggcgaggcccaggccttccgggccctg
gtgcaggagaagatccaaaaaaggaatcagaggcaaagtggagatagacgccagctaccc
gcaccaccagcaccagccaatgaagagagaagaggagggctcccacccttgcccccacat
ccaggtggagaccaaggaggcctggcatctgggcaactgtccctggggctagtaacagtg
gacatccagaacccggacatcacgagttcacgataccgtgggctcccagcacctgggcct
ggcccagctgataagaaacgctcagggaagaagaagatcagcaaggctgatattggcgca
ccaagtggattcaaacatgtcagccacgtggggtgggacccccagaatggatttgacgta
aataacctggacccggacctgcggagtctgttctccagggcaggaatcagtgaggcccag
ctcacggatgccgagacctccaaacttatctacgatttcattgaggaccagggtggcctg
gaggctgtgcggcaggagatgaggcgccaggaaccgcttccaccgcccccaccaccatcc
agaggaggaaaccaggccccccggccccctactgtggggagcagtaagggtcgttctggt
ccactgccccctgtacctttgggaggtgctccacccccacccactccccggggaccccca
cccccaggccgagggggccctccaccaccaccccctccagccactggacgttccggacca
ctgccccctccgccccctggagctggagggccccccgtgcctccaccccccccaccccca
cccccaccacccagctctggggatgggccaatccctcccccacctcctgctctggggccc
acggggggcctggctcctggtggaggtcggggggcacttttggatcaaatccggcaggga
attcagctgaacaagacgcccggggccccagagagctcagccttgcagcctccgcctcag
agctcagaagggctggtgggagccctgatgcatgtgatgcagaagagaagcaaagccatc
cactcctcagacgaaggggaggaccaggccggcgacgaggatgaggacgatgagtgggac
gactga

DBGET integrated database retrieval system