KEGG   Ursus arctos horribilis: 113267611
Entry
113267611         CDS       T05909                                 

Gene name
IL21R
Definition
(RefSeq) interleukin-21 receptor
  KO
K05075  interleukin 21 receptor
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04630  Jak-STAT signaling pathway
uah04659  Th17 cell differentiation
uah05321  Inflammatory bowel disease (IBD)
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113267611 (IL21R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113267611 (IL21R)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    113267611 (IL21R)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    113267611 (IL21R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:uah04050]
    113267611 (IL21R)
   04090 CD molecules [BR:uah04090]
    113267611 (IL21R)
Cytokine receptors [BR:uah04050]
 Interleukin receptor families
  IL2 receptor family
   113267611 (IL21R)
CD molecules [BR:uah04090]
 Proteins
  113267611 (IL21R)
SSDB
Motif
Pfam: IL4Ra_N EpoR_lig-bind
Other DBs
NCBI-GeneID: 113267611
NCBI-ProteinID: XP_026371439
UniProt: A0A3Q7X2F5
LinkDB
Position
Unknown
AA seq 545 aa
MLCGSVASLFLLMLQWAWGCRDLVCYTDYFQTVTCTLETRTLHPGMLTLTWQDPYGELED
EVTSCSLHRSAHNATHAKYTCHMDVFRFMADDIFSVNVTDQSGSYSQECGSFVLADSIKP
SPPFNVTVTMNFSGHYNISWSSNYDSYALKGKLQFELRYRKWGGPWALSPGRKLISVDSR
SVSLLPLEFQSDSSYELQIRAGPQAGSSFQGTWSEWSDPVIFHTQPEEIKGGWRTYLLYL
LLVIILPILVFLGLKIHLPWRLWKKVWGQVPSPQKFFQPLYVGHSGDFKKWVGAPFTASS
LELGPRSPEVLSSLQTHTCCPPRSATKGLQPTQLLESTDLVEADGLPELGFWGLAPFTAG
SLGGSAYSQERDRPYGVVLSIDTVTVADTEGPCAWSCTCGDDGYPALNLDASLEPSSGAE
DPLLDTGTTVLSCGCVSTGGLAGLGGPPGSLLDGLKLPLEDEAGWTPGPPWSGGPPRGAS
DSEAGSPPAGLDMDTFDSGFAGSDCGSPVECDFTSPSDEGPPRSYLRQWVVMAPPPEGPG
PQASQ
NT seq 1638 nt   +upstreamnt  +downstreamnt
atgttgtgtggctcggtggcctctctcttcctgctgatgctccagtgggcctgggggtgc
cgagacctcgtctgctacaccgattacttccaaacagtcacctgcaccctggagacaagg
accctccacccgggcatgctcaccctcacctggcaagacccatatggagaactggaggac
gaggtcacctcctgcagcctccaccggtccgcccacaacgccacgcatgccaagtacaca
tgccacatggatgtgtttcgattcatggccgacgacattttcagcgtcaatgtcacggac
cagtccggaagttactcccaggagtgtggcagcttcgtcctggccgacagcatcaagccg
tccccccctttcaacgtgaccgtgaccatgaacttctcaggacattataacatctcctgg
agctccaattacgattcctacgcgctgaagggcaagctgcagtttgagctgcgatacagg
aagtggggaggcccctgggctctgagtccggggagaaagctgatctcggtggattcgaga
agcgtctctctccttcccttggagttccagagcgactcgagctatgagctgcagatacgc
gcagggccccaggccggctcgtccttccaggggacctggagtgagtggagtgacccagtc
atctttcacacccagccggaagagataaagggaggctggcgtacttacctgctgtatctc
ctcctggtcatcatactccccatcctcgtcttcttaggcctgaagatccacctgccttgg
aggctgtggaagaaggtgtggggacaggtgcccagcccacagaagttcttccagcccctc
tacgtgggccacagtggagacttcaagaaatgggtgggtgcacccttcactgcctccagc
ctggagctgggaccccggagccccgaggtgctctcttccctgcagacacacacctgctgc
cctccgcggagcgccaccaaggggctgcagcccacgcagctgctggagtccactgacctg
gtggaagctgatgggctgcctgagctgggcttctggggcctggcccccttcactgctggc
agcttgggtggctcggcttacagccaggagagggaccgaccatatggcgtcgtactctcc
attgacacggtgaccgtagcagacacagaggggccgtgtgcctggtcctgcacctgtggg
gatgatggctacccagccctgaacttggacgccagcctggagcccagctcaggcgccgag
gacccgctcttggacaccgggactacggtcctctcctgtggctgcgtctcgactggtggc
cttgccgggctgggaggccctcctggcagcctcctcgacggactaaagctgccccttgaa
gatgaggcaggttggaccccggggccgccgtggagtggcgggccccccagaggggcgtcg
gacagcgaagcgggctcgcctcccgccggcctggacatggacacttttgacagcggcttc
gcgggctctgactgcggcagccccgtggagtgtgacttcaccagccccagtgacgaaggg
ccccccaggagctacctccgccagtgggtggtcatggcccctccccctgagggcccaggg
ccccaggccagccagtga

DBGET integrated database retrieval system