KEGG   Ursus maritimus (polar bear): 103656206Help
Entry
103656206         CDS       T03271                                 

Gene name
STAT2
Definition
(RefSeq) signal transducer and activator of transcription 2
  KO
K11221  signal transducer and activator of transcription 2
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04062  Chemokine signaling pathway
umr04217  Necroptosis
umr04380  Osteoclast differentiation
umr04621  NOD-like receptor signaling pathway
umr04625  C-type lectin receptor signaling pathway
umr04630  Jak-STAT signaling pathway
umr05160  Hepatitis C
umr05161  Hepatitis B
umr05162  Measles
umr05164  Influenza A
umr05165  Human papillomavirus infection
umr05167  Kaposi sarcoma-associated herpesvirus infection
umr05168  Herpes simplex virus 1 infection
umr05169  Epstein-Barr virus infection
umr05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    103656206 (STAT2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    103656206 (STAT2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    103656206 (STAT2)
   04625 C-type lectin receptor signaling pathway
    103656206 (STAT2)
   04062 Chemokine signaling pathway
    103656206 (STAT2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103656206 (STAT2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103656206 (STAT2)
  09172 Infectious disease: viral
   05162 Measles
    103656206 (STAT2)
   05164 Influenza A
    103656206 (STAT2)
   05161 Hepatitis B
    103656206 (STAT2)
   05160 Hepatitis C
    103656206 (STAT2)
   05168 Herpes simplex virus 1 infection
    103656206 (STAT2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103656206 (STAT2)
   05169 Epstein-Barr virus infection
    103656206 (STAT2)
   05165 Human papillomavirus infection
    103656206 (STAT2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:umr03000]
    103656206 (STAT2)
Transcription factors [BR:umr03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    103656206 (STAT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: STAT_alpha STAT2_C STAT_int STAT_bind SH2 LXG
Motif
Other DBs
NCBI-GeneID: 103656206
NCBI-ProteinID: XP_008681792
UniProt: A0A384BGU1
LinkDB All DBs
Position
Un
AA seq 854 aa AA seqDB search
MAQWEMLQNLSSPFQDRLHQLYSDSLLPMDIRQCLAVWIEDQNWQEAALGNDDSKATVLF
FHFLDQLNNECGRCSQDPDLLLLQHNLRKFSRDIQAFPQGPTQLAEMIFNLLLEEKRILI
QAQRAQLEQGEPALEAPVESQQHEIESRILELKTMMETLVKSISQLKDQQDVFCFRYKTQ
AQVKTLSLDPHQTRQRQLLQETLNELDRRRKEALDATKALLGQLTTLVELLLPKLEEWKV
QQQKACVGAPLDAGLEQLEKWFTAGARLLFHLRQLLKELEGLSRLVSYKDDPLTTGVDLR
KAQVTELLQHLLQRAFVVETQPCMPQIPHRPLILKTGSKFIVQARLLVRLQEGNESLTAE
VSIDRNPPQSQGFRKFNILTSNQKTLTPEKGQSQGLIWDFGYLTLVEQRSGGSGKGCNKG
MLGVTEELHVISITVNYTYQGLKQELRTDTLPVVIISNMSQVSIAWASVLWFNLLSSNPQ
NQQFFSSPPKAPWSLLGPALSWQFSSYVGRGLDPDQLSMLRNKLFGQNSRTEGASLSWAD
FTKRESPPGKLPFWTWLDKILELVHDHLKDLWNDGRIMGFVSRSQERKLLKKTISGTFLL
RFSETSEGGITCSWVEHQDDDRVLIYSVQPFTKEVLQSLPLTKIIRHYQLLTDENIPENP
LCFLYPRIPRDEAFGHYYQEKVNLEERRKYLKHKLIVVSNRQVDELQQPPDLKLEPEAES
FELESGLAPLLQLEPGLELEPLLEAGLNLGPALEPLLEPALDVAQRVSEPDLGPELKLEP
ILDPASQAVPEPDLPHDLRHLNTEEMEIFRNSMKIEEIMPNGDPLFAGQNTVDEAYAFHP
SHFCTDGPLIPSDY
NT seq 2565 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagtgggagatgttgcagaatctcagcagcccatttcaggaccggctgcaccag
ctgtactcagatagcctcctgccaatggacattcgacagtgcttagctgtctggattgaa
gaccagaactggcaggaggctgcactgggcaatgatgattccaaggctaccgtgctgttc
ttccacttcttggaccaactgaacaacgagtgtggccgctgcagccaggaccccgatctc
ttgttactacagcacaacttgcgaaaattctctcgggatattcaggcctttccccagggc
cctacccaattggctgagatgatctttaatctccttctggaagaaaaaagaattctgatc
caggcccagagggctcagttggagcaaggagagccagccctcgaagcacccgtagagagc
cagcagcatgagattgagtcccggatactggaattaaagactatgatggagacgctggtg
aaatccatctcccagctgaaagaccagcaggatgtcttctgcttccggtataagacccag
gcccaagtgaagacactctctttagacccccatcagacgagacagcggcagctgctgcag
gagactctcaatgaactggacagaaggagaaaggaggcgctggacgccaccaaagccttg
ctaggccaattaacaaccctcgttgagctactgctgcccaagttggaggaatggaaagtc
cagcagcagaaagcctgcgttggagcccctctggatgcagggttggaacagctggagaag
tggttcacagccggagccaggctgctgtttcacctgcgtcagctgttgaaggagctggag
ggactgagtcgcctggttagctataaggatgaccctctgaccaccggggtggacctgcgg
aaggcccaggtcacggagttgctacagcacctgctccagagggcctttgtggtagaaacc
cagccctgcatgccccaaattccccatcgacccctcatcctcaagactgggagcaagttc
attgtccaagcaaggctgctcgtgagactccaggaaggcaatgagtcactaacggcagaa
gtctccattgacaggaatcctcctcagtcacaaggcttccggaagttcaacattctaacc
tcaaaccagaaaactttgacccccgagaaggggcagagtcagggcttaatttgggacttc
ggctatctgactctagtggagcaacgttcaggtggctcaggaaagggctgcaataaggga
atgctgggcgtgacagaggagctgcacgtcatcagcattacggtcaactacacctaccag
ggtctgaagcaggagctgagaacggacaccctccctgtggtgattatatctaacatgagc
caagtctccattgcctgggcctcggttctttggttcaatctgcttagctcaaacccccag
aatcagcagttcttctccagcccccccaaggccccctggagcttgctgggccctgctctc
agttggcagttctcctcctacgttggccgaggccttgacccagaccagctgagcatgctg
aggaacaagctgtttgggcagaactctaggactgagggtgcatcgttatcctgggctgac
ttcactaagcgagagagccctcctggcaagctaccattctggacatggttagacaaaatt
ctggagctggtgcatgaccacctgaaggatctctggaatgatggacgcatcatgggcttt
gtgagccggagccaggagcgcaagctgctgaagaagaccatctccggcaccttcctgctg
cgcttcagcgagacgtcggagggaggcattacctgctcctgggtggaacaccaggacgat
gatagggtgctcatctactctgtgcagcccttcaccaaggaagtgctgcagtctctcccg
ctgaccaaaatcattcgccactaccagctgctcacggacgagaacatccccgagaaccca
ctgtgcttcctctacccccggataccccgggatgaggctttcgggcactactaccaggag
aaagttaacctcgaggaacggaggaagtacctgaaacataagctcattgtggtctctaac
agacaggtcgatgagctgcagcaaccaccggaccttaagctggagccagaagcggagtcg
tttgagctggagtcaggactggccccactgctacagctagagccaggcctggagttggag
ccactgctggaggcaggactgaatctggggccagccctggagcccctgctggagcccgca
ctggatgtggcacaaagagtgtcagagccagacttgggaccagagctgaagctggagcct
attctagaccccgcatcacaggcagtgccagagccagatttgccccatgatctgagacac
ttgaacaccgaggaaatggaaatcttcagaaacagtatgaagattgaagaaatcatgcca
aatggtgacccactgtttgctggacagaacaccgtggacgaggcttacgctttccatccc
agccatttctgcacggacgggcccttgattccttctgactactag

DBGET integrated database retrieval system