KEGG   Ursus maritimus (polar bear): 103657107
Entry
103657107         CDS       T03271                                 

Gene name
BAX
Definition
(RefSeq) BCL2 associated X, apoptosis regulator
  KO
K02159  apoptosis regulator BAX
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01521  EGFR tyrosine kinase inhibitor resistance
umr01522  Endocrine resistance
umr01524  Platinum drug resistance
umr04071  Sphingolipid signaling pathway
umr04115  p53 signaling pathway
umr04141  Protein processing in endoplasmic reticulum
umr04210  Apoptosis
umr04211  Longevity regulating pathway
umr04215  Apoptosis - multiple species
umr04217  Necroptosis
umr04722  Neurotrophin signaling pathway
umr04932  Non-alcoholic fatty liver disease
umr04933  AGE-RAGE signaling pathway in diabetic complications
umr05012  Parkinson disease
umr05014  Amyotrophic lateral sclerosis
umr05016  Huntington disease
umr05020  Prion disease
umr05022  Pathways of neurodegeneration - multiple diseases
umr05132  Salmonella infection
umr05152  Tuberculosis
umr05160  Hepatitis C
umr05161  Hepatitis B
umr05162  Measles
umr05163  Human cytomegalovirus infection
umr05164  Influenza A
umr05165  Human papillomavirus infection
umr05166  Human T-cell leukemia virus 1 infection
umr05167  Kaposi sarcoma-associated herpesvirus infection
umr05168  Herpes simplex virus 1 infection
umr05169  Epstein-Barr virus infection
umr05170  Human immunodeficiency virus 1 infection
umr05200  Pathways in cancer
umr05202  Transcriptional misregulation in cancer
umr05203  Viral carcinogenesis
umr05210  Colorectal cancer
umr05212  Pancreatic cancer
umr05213  Endometrial cancer
umr05214  Glioma
umr05216  Thyroid cancer
umr05217  Basal cell carcinoma
umr05218  Melanoma
umr05220  Chronic myeloid leukemia
umr05222  Small cell lung cancer
umr05223  Non-small cell lung cancer
umr05224  Breast cancer
umr05225  Hepatocellular carcinoma
umr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    103657107 (BAX)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    103657107 (BAX)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103657107 (BAX)
   04215 Apoptosis - multiple species
    103657107 (BAX)
   04217 Necroptosis
    103657107 (BAX)
   04115 p53 signaling pathway
    103657107 (BAX)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    103657107 (BAX)
  09149 Aging
   04211 Longevity regulating pathway
    103657107 (BAX)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103657107 (BAX)
   05202 Transcriptional misregulation in cancer
    103657107 (BAX)
   05203 Viral carcinogenesis
    103657107 (BAX)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103657107 (BAX)
   05212 Pancreatic cancer
    103657107 (BAX)
   05225 Hepatocellular carcinoma
    103657107 (BAX)
   05226 Gastric cancer
    103657107 (BAX)
   05214 Glioma
    103657107 (BAX)
   05216 Thyroid cancer
    103657107 (BAX)
   05220 Chronic myeloid leukemia
    103657107 (BAX)
   05217 Basal cell carcinoma
    103657107 (BAX)
   05218 Melanoma
    103657107 (BAX)
   05213 Endometrial cancer
    103657107 (BAX)
   05224 Breast cancer
    103657107 (BAX)
   05222 Small cell lung cancer
    103657107 (BAX)
   05223 Non-small cell lung cancer
    103657107 (BAX)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    103657107 (BAX)
   05014 Amyotrophic lateral sclerosis
    103657107 (BAX)
   05016 Huntington disease
    103657107 (BAX)
   05020 Prion disease
    103657107 (BAX)
   05022 Pathways of neurodegeneration - multiple diseases
    103657107 (BAX)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    103657107 (BAX)
   04933 AGE-RAGE signaling pathway in diabetic complications
    103657107 (BAX)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103657107 (BAX)
   05152 Tuberculosis
    103657107 (BAX)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103657107 (BAX)
   05170 Human immunodeficiency virus 1 infection
    103657107 (BAX)
   05161 Hepatitis B
    103657107 (BAX)
   05160 Hepatitis C
    103657107 (BAX)
   05164 Influenza A
    103657107 (BAX)
   05162 Measles
    103657107 (BAX)
   05168 Herpes simplex virus 1 infection
    103657107 (BAX)
   05163 Human cytomegalovirus infection
    103657107 (BAX)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103657107 (BAX)
   05169 Epstein-Barr virus infection
    103657107 (BAX)
   05165 Human papillomavirus infection
    103657107 (BAX)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103657107 (BAX)
   01524 Platinum drug resistance
    103657107 (BAX)
   01522 Endocrine resistance
    103657107 (BAX)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:umr03029]
    103657107 (BAX)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:umr02000]
    103657107 (BAX)
Mitochondrial biogenesis [BR:umr03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    103657107 (BAX)
Transporters [BR:umr02000]
 Other transporters
  Pores ion channels [TC:1]
   103657107 (BAX)
SSDB
Motif
Pfam: Bcl-2 CF222
Other DBs
NCBI-GeneID: 103657107
NCBI-ProteinID: XP_008682745
UniProt: A0A384BKV5
LinkDB
Position
Un
AA seq 205 aa
MSHPSSLDPLGPKSPGTSSLLSPLGPTSSEQIMKTGALLLQGFIQDRAGRMGGETPELAL
EQVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNW
GRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGT
PTWQTVTIFVAGVLTASLTIWKKMG
NT seq 618 nt   +upstreamnt  +downstreamnt
atgagccaccctagttccctggatcccctaggacccaagagtccaggcacctcttccctc
ctttctcctctagggcccaccagctctgagcagatcatgaagacaggggcccttttgctt
cagggtttcatccaagatcgagcagggcgaatggggggagagacacctgagctggccctg
gagcaggtgccccaggacgcatccaccaagaagctgagcgagtgtctcaagcgcatcgga
gatgaactggacagtaacatggagttacagaggatgatcgcagccgtggacacagactca
ccccgcgaggtctttttccgagtggcagctgacatgttttctgatggcaacttcaactgg
ggccgggttgttgccctcttctactttgccagcaaactggtgctcaaggccctgtgtacc
aaggtgcccgagctgataaggaccatcatgggctggacactggacttccttcgagagcgg
ctgctgggctggatccaggaccagggtggttgggacggcctcctctcctactttgggaca
cccacgtggcagacagtgaccatctttgtggctggagtgctcactgcgtcactcaccatc
tggaaaaagatgggctga

DBGET integrated database retrieval system