KEGG   Ursus maritimus (polar bear): 103658902
Entry
103658902         CDS       T03271                                 

Definition
(RefSeq) cytochrome c
  KO
K08738  cytochrome c
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01524  Platinum drug resistance
umr04115  p53 signaling pathway
umr04210  Apoptosis
umr04215  Apoptosis - multiple species
umr04932  Non-alcoholic fatty liver disease
umr05010  Alzheimer disease
umr05012  Parkinson disease
umr05014  Amyotrophic lateral sclerosis
umr05016  Huntington disease
umr05017  Spinocerebellar ataxia
umr05020  Prion disease
umr05022  Pathways of neurodegeneration - multiple diseases
umr05132  Salmonella infection
umr05134  Legionellosis
umr05145  Toxoplasmosis
umr05152  Tuberculosis
umr05160  Hepatitis C
umr05161  Hepatitis B
umr05162  Measles
umr05163  Human cytomegalovirus infection
umr05164  Influenza A
umr05167  Kaposi sarcoma-associated herpesvirus infection
umr05168  Herpes simplex virus 1 infection
umr05169  Epstein-Barr virus infection
umr05170  Human immunodeficiency virus 1 infection
umr05200  Pathways in cancer
umr05210  Colorectal cancer
umr05222  Small cell lung cancer
umr05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:umr00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103658902
   04215 Apoptosis - multiple species
    103658902
   04115 p53 signaling pathway
    103658902
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103658902
  09162 Cancer: specific types
   05210 Colorectal cancer
    103658902
   05222 Small cell lung cancer
    103658902
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103658902
   05012 Parkinson disease
    103658902
   05014 Amyotrophic lateral sclerosis
    103658902
   05016 Huntington disease
    103658902
   05017 Spinocerebellar ataxia
    103658902
   05020 Prion disease
    103658902
   05022 Pathways of neurodegeneration - multiple diseases
    103658902
  09166 Cardiovascular disease
   05416 Viral myocarditis
    103658902
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    103658902
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103658902
   05134 Legionellosis
    103658902
   05152 Tuberculosis
    103658902
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103658902
   05161 Hepatitis B
    103658902
   05160 Hepatitis C
    103658902
   05164 Influenza A
    103658902
   05162 Measles
    103658902
   05168 Herpes simplex virus 1 infection
    103658902
   05163 Human cytomegalovirus infection
    103658902
   05167 Kaposi sarcoma-associated herpesvirus infection
    103658902
   05169 Epstein-Barr virus infection
    103658902
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103658902
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    103658902
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Other DBs
NCBI-GeneID: 103658902
NCBI-ProteinID: XP_008684633
UniProt: A0A384BPV9
LinkDB
Position
Un
AA seq 105 aa
MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFSYTDANKNKGITW
GEETLMEYLENPKKYIPGTKMIFAGIKKTGERADLIAYLKKATKE
NT seq 318 nt   +upstreamnt  +downstreamnt
atgggtgatgttgagaagggcaagaagatttttgttcagaagtgtgcccagtgccatacc
gtggaaaagggaggcaagcacaagactgggccaaatctccatggtttatttggccgaaag
acaggtcaggcccctggattttcttacacggatgccaacaagaacaaaggcatcacctgg
ggagaggagacactgatggagtatttggagaatcccaagaagtacatccctggaacaaaa
atgatcttcgctggcattaagaagacaggggaaagagcagacttgatagcttatctcaaa
aaagctactaaggagtaa

DBGET integrated database retrieval system