KEGG   Ursus maritimus (polar bear): 103660144
Entry
103660144         CDS       T03271                                 

Gene name
KITLG
Definition
(RefSeq) KIT ligand
  KO
K05461  KIT ligand
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04010  MAPK signaling pathway
umr04014  Ras signaling pathway
umr04015  Rap1 signaling pathway
umr04072  Phospholipase D signaling pathway
umr04151  PI3K-Akt signaling pathway
umr04640  Hematopoietic cell lineage
umr04916  Melanogenesis
umr05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103660144 (KITLG)
   04014 Ras signaling pathway
    103660144 (KITLG)
   04015 Rap1 signaling pathway
    103660144 (KITLG)
   04072 Phospholipase D signaling pathway
    103660144 (KITLG)
   04151 PI3K-Akt signaling pathway
    103660144 (KITLG)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    103660144 (KITLG)
  09152 Endocrine system
   04916 Melanogenesis
    103660144 (KITLG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103660144 (KITLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:umr04052]
    103660144 (KITLG)
Cytokines and growth factors [BR:umr04052]
 Growth factors
  Growth factors (RTK binding)
   103660144 (KITLG)
SSDB
Motif
Pfam: SCF Psg1
Other DBs
NCBI-GeneID: 103660144
NCBI-ProteinID: XP_008685967
UniProt: A0A384BTQ8
LinkDB
Position
Un
AA seq 468 aa
MGEQQIPIKLPPPPRRGGVNSLLSTQCTLANRLSVKRGSSQLSLARVCPRAVPEGAREAG
VACESEPPWPGEPDRRSGSDERELVSSLEPQPLSLELSVGTAVPVKWKDLLFGRRVKLSG
EGISLHGRYFPVDSGSLQNRSQRTTLAHCRTQVFVQPLGGRGARADSGAAAGVKPTGENL
PGQPGKLGSARSLPGLRLWTWIITCIYLQLLLFNPLVKTKGICRNRVTDDVKDVTKLVAN
LPKDYKIALKYVPGMDVLPSHCWISVMVEQLSVSLTDLLDKFSNISEGLSNYSIIDKLVK
IVDDLVECMEEHSFENVKKSPKSPELRHFTPEEFFRIFNRSIDALKDLETVASKSSECVV
SSTLSPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKASNPIGDSSLQWAAMALPAFFS
LVIGFAFGALYWKKKQPNLTRTVENIQINEEDNEISMLQEKEREFQEV
NT seq 1407 nt   +upstreamnt  +downstreamnt
atgggcgaacaacagatcccaattaagctccccccgcccccaaggcggggtggggtgaat
tctttgctaagcacccagtgtactctagcgaaccgcctcagtgtaaaaagggggagctcc
cagctctccttagctcgcgtctgtccccgggcggtgccagagggtgcgagggaggcgggc
gtggcgtgcgagtcggagccgccctggccgggtgagccagacagaaggagtgggagcgat
gagagggagctggtgtcaagtttggagccgcagccgttaagtttggagctgtcagtcgga
accgcagttcctgtaaaatggaaggatctgctctttggccggagagttaagttatcagga
gaaggcatttctctgcacgggagatattttcccgtggattccgggagcttacaaaaccgc
tcccagcgcactacgctcgctcactgtcgaacgcaggtttttgtgcagcccctaggtggg
cgcggggctcgtgcggactcgggtgcagccgcgggagtgaagccaacaggagagaacctg
cccggccagcccggaaaacttggctctgcgcggtctttgccaggtttgcggctctggact
tggattatcacttgcatttatcttcaactactcctatttaatcctctggtcaaaactaaa
gggatctgcaggaaccgtgtgactgatgatgtgaaagacgttacaaaattggtggcaaat
cttccaaaagactataagatagccctcaaatatgtccccgggatggatgttttgcctagt
cattgttggataagcgtgatggtggaacagttgtcagtcagcttaactgatcttctggac
aaattttcaaatatttctgaaggcttgagtaattactctatcatagacaaacttgtgaaa
atagtggatgaccttgtggagtgcatggaagaacactcatttgagaatgtaaaaaaatca
cctaaaagcccagaactcaggcattttacccctgaagaattcttcagaatttttaataga
tccattgatgccctcaaggacttggagacggtggcatctaaaagtagtgaatgtgtggtc
tcttcaacattaagtcctgaaaaagattccagagtcagtgtcacaaaaccatttatgtta
ccccctgttgcagccagctcccttaggaatgacagcagtagcagtaataggaaggcctca
aaccccattggagactccagcttacaatgggcagccatggcattgccagcattcttctct
cttgtaattgggtttgcttttggagccttatactggaagaagaaacaaccaaatctcaca
aggacagttgaaaatatacagattaatgaagaggataatgaaataagtatgttgcaagaa
aaagagagagagtttcaagaggtgtaa

DBGET integrated database retrieval system