KEGG   Ursus maritimus (polar bear): 103660510
Entry
103660510         CDS       T03271                                 

Gene name
MAP2K4
Definition
(RefSeq) mitogen-activated protein kinase kinase 4
  KO
K04430  mitogen-activated protein kinase kinase 4 [EC:2.7.12.2]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04010  MAPK signaling pathway
umr04012  ErbB signaling pathway
umr04620  Toll-like receptor signaling pathway
umr04664  Fc epsilon RI signaling pathway
umr04668  TNF signaling pathway
umr04912  GnRH signaling pathway
umr04926  Relaxin signaling pathway
umr04935  Growth hormone synthesis, secretion and action
umr05132  Salmonella infection
umr05135  Yersinia infection
umr05142  Chagas disease
umr05161  Hepatitis B
umr05166  Human T-cell leukemia virus 1 infection
umr05167  Kaposi sarcoma-associated herpesvirus infection
umr05169  Epstein-Barr virus infection
umr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103660510 (MAP2K4)
   04012 ErbB signaling pathway
    103660510 (MAP2K4)
   04668 TNF signaling pathway
    103660510 (MAP2K4)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103660510 (MAP2K4)
   04664 Fc epsilon RI signaling pathway
    103660510 (MAP2K4)
  09152 Endocrine system
   04912 GnRH signaling pathway
    103660510 (MAP2K4)
   04926 Relaxin signaling pathway
    103660510 (MAP2K4)
   04935 Growth hormone synthesis, secretion and action
    103660510 (MAP2K4)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103660510 (MAP2K4)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103660510 (MAP2K4)
   05135 Yersinia infection
    103660510 (MAP2K4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103660510 (MAP2K4)
   05161 Hepatitis B
    103660510 (MAP2K4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103660510 (MAP2K4)
   05169 Epstein-Barr virus infection
    103660510 (MAP2K4)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    103660510 (MAP2K4)
Enzymes [BR:umr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     103660510 (MAP2K4)
Protein kinases [BR:umr01001]
 Serine/threonine kinases: STE group
  STE7 family
   103660510 (MAP2K4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Seadorna_VP7 Pkinase_fungal APH
Other DBs
NCBI-GeneID: 103660510
NCBI-ProteinID: XP_008686349
UniProt: A0A384BVT3
LinkDB
Position
Un
AA seq 403 aa
MASEGLSRLSLSSTSSPVIAVNELELISFTLGFQINFCEKAQSKRKALKLNFANPPFKST
ARFTLNPNPTGVQNPHIERLRTHSIESSGKLKISPEQHWDFTAEDLKDLGEIGRGAYGSV
NKMVHKPSGQIMAVKRIRSTVDEKEQKQLLMDLDVVMRSSDCPYIVQFYGALFREGDCWI
CMELMSTSFDKFYKYVYSVLDDVIPEEILGKITLATVKALNHLKENLKIIHRDIKPSNIL
LDRSGNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQGYDVRSDVWSLGIT
LYELATGRFPYPKWNSVFDQLTQVVKGDPPQLSNSEEREFSPSFINFVNLCLTKDESKRP
KYKELLKHPFILMYEERSVEVACYVCKILDQMPATPSSPMYVD
NT seq 1212 nt   +upstreamnt  +downstreamnt
atggccagtgaagggctgtcacgattgagtctttcatccacctcctctccagttattgca
gtcaatgaactggaacttatctcttttactttaggctttcagataaacttctgtgaaaag
gcacaaagtaaacgcaaagcactgaagttgaattttgcaaatccacccttcaaatctaca
gcaaggtttactctgaaccccaaccctacaggagtgcaaaacccacacatagagagactg
agaacacacagcattgaatcgtcaggaaaactgaagatctcccctgagcaacactgggat
ttcactgcggaggacttgaaagaccttggagaaattggacgaggagcttatggttctgtc
aacaaaatggtccacaaaccaagtgggcaaataatggcagttaaaagaattcggtcaaca
gtggatgaaaaagaacaaaaacaacttcttatggatttggatgtagtaatgcggagtagt
gattgcccatacattgttcagttttatggtgcactcttcagagagggtgactgttggatc
tgtatggaactcatgtctacctcgtttgataagttttacaaatatgtatatagtgtatta
gatgatgttattccagaagaaattttaggcaaaatcactttagcaactgtgaaagcacta
aaccacttaaaagaaaacttgaaaatcattcacagagatatcaaaccttccaatattctt
ctggacaggagtggaaatattaagctctgtgactttggcatcagtggacagctggtggac
tccattgccaagacaagagatgccgggtgtaggccatacatggcacctgaaagaatagac
ccgagtgcgtcgcgacaaggatatgacgtccgctctgatgtctggagtttggggatcaca
ttgtacgagttagccacaggccggtttccttatccaaagtggaatagtgtattcgatcaa
ctcacacaagtcgtgaaaggggaccctccacagctgagtaactctgaagaaagggagttc
tccccgagcttcatcaactttgtcaacttgtgccttacgaaggatgaatccaaaaggcca
aagtataaggaacttctgaaacatccctttattttgatgtatgaagagcgtagcgtagag
gtcgcctgctacgtgtgtaaaatcctggatcagatgccagcgacccccagctctcccatg
tacgtcgactga

DBGET integrated database retrieval system