KEGG   Ursus maritimus (polar bear): 103661038
Entry
103661038         CDS       T03271                                 

Gene name
AKT2
Definition
(RefSeq) AKT serine/threonine kinase 2
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01521  EGFR tyrosine kinase inhibitor resistance
umr01522  Endocrine resistance
umr01524  Platinum drug resistance
umr04010  MAPK signaling pathway
umr04012  ErbB signaling pathway
umr04014  Ras signaling pathway
umr04015  Rap1 signaling pathway
umr04022  cGMP-PKG signaling pathway
umr04024  cAMP signaling pathway
umr04062  Chemokine signaling pathway
umr04066  HIF-1 signaling pathway
umr04068  FoxO signaling pathway
umr04071  Sphingolipid signaling pathway
umr04072  Phospholipase D signaling pathway
umr04140  Autophagy - animal
umr04150  mTOR signaling pathway
umr04151  PI3K-Akt signaling pathway
umr04152  AMPK signaling pathway
umr04210  Apoptosis
umr04211  Longevity regulating pathway
umr04213  Longevity regulating pathway - multiple species
umr04218  Cellular senescence
umr04261  Adrenergic signaling in cardiomyocytes
umr04370  VEGF signaling pathway
umr04371  Apelin signaling pathway
umr04380  Osteoclast differentiation
umr04510  Focal adhesion
umr04550  Signaling pathways regulating pluripotency of stem cells
umr04611  Platelet activation
umr04613  Neutrophil extracellular trap formation
umr04620  Toll-like receptor signaling pathway
umr04625  C-type lectin receptor signaling pathway
umr04630  JAK-STAT signaling pathway
umr04660  T cell receptor signaling pathway
umr04662  B cell receptor signaling pathway
umr04664  Fc epsilon RI signaling pathway
umr04666  Fc gamma R-mediated phagocytosis
umr04668  TNF signaling pathway
umr04722  Neurotrophin signaling pathway
umr04725  Cholinergic synapse
umr04728  Dopaminergic synapse
umr04910  Insulin signaling pathway
umr04914  Progesterone-mediated oocyte maturation
umr04915  Estrogen signaling pathway
umr04917  Prolactin signaling pathway
umr04919  Thyroid hormone signaling pathway
umr04920  Adipocytokine signaling pathway
umr04922  Glucagon signaling pathway
umr04923  Regulation of lipolysis in adipocytes
umr04926  Relaxin signaling pathway
umr04929  GnRH secretion
umr04931  Insulin resistance
umr04932  Non-alcoholic fatty liver disease
umr04933  AGE-RAGE signaling pathway in diabetic complications
umr04935  Growth hormone synthesis, secretion and action
umr04973  Carbohydrate digestion and absorption
umr05010  Alzheimer disease
umr05017  Spinocerebellar ataxia
umr05132  Salmonella infection
umr05135  Yersinia infection
umr05142  Chagas disease
umr05145  Toxoplasmosis
umr05152  Tuberculosis
umr05160  Hepatitis C
umr05161  Hepatitis B
umr05162  Measles
umr05163  Human cytomegalovirus infection
umr05164  Influenza A
umr05165  Human papillomavirus infection
umr05166  Human T-cell leukemia virus 1 infection
umr05167  Kaposi sarcoma-associated herpesvirus infection
umr05168  Herpes simplex virus 1 infection
umr05169  Epstein-Barr virus infection
umr05170  Human immunodeficiency virus 1 infection
umr05200  Pathways in cancer
umr05205  Proteoglycans in cancer
umr05210  Colorectal cancer
umr05211  Renal cell carcinoma
umr05212  Pancreatic cancer
umr05213  Endometrial cancer
umr05214  Glioma
umr05215  Prostate cancer
umr05218  Melanoma
umr05220  Chronic myeloid leukemia
umr05221  Acute myeloid leukemia
umr05222  Small cell lung cancer
umr05223  Non-small cell lung cancer
umr05224  Breast cancer
umr05225  Hepatocellular carcinoma
umr05226  Gastric cancer
umr05230  Central carbon metabolism in cancer
umr05231  Choline metabolism in cancer
umr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
umr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103661038 (AKT2)
   04012 ErbB signaling pathway
    103661038 (AKT2)
   04014 Ras signaling pathway
    103661038 (AKT2)
   04015 Rap1 signaling pathway
    103661038 (AKT2)
   04370 VEGF signaling pathway
    103661038 (AKT2)
   04371 Apelin signaling pathway
    103661038 (AKT2)
   04630 JAK-STAT signaling pathway
    103661038 (AKT2)
   04668 TNF signaling pathway
    103661038 (AKT2)
   04066 HIF-1 signaling pathway
    103661038 (AKT2)
   04068 FoxO signaling pathway
    103661038 (AKT2)
   04072 Phospholipase D signaling pathway
    103661038 (AKT2)
   04071 Sphingolipid signaling pathway
    103661038 (AKT2)
   04024 cAMP signaling pathway
    103661038 (AKT2)
   04022 cGMP-PKG signaling pathway
    103661038 (AKT2)
   04151 PI3K-Akt signaling pathway
    103661038 (AKT2)
   04152 AMPK signaling pathway
    103661038 (AKT2)
   04150 mTOR signaling pathway
    103661038 (AKT2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103661038 (AKT2)
  09143 Cell growth and death
   04210 Apoptosis
    103661038 (AKT2)
   04218 Cellular senescence
    103661038 (AKT2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103661038 (AKT2)
   04550 Signaling pathways regulating pluripotency of stem cells
    103661038 (AKT2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103661038 (AKT2)
   04613 Neutrophil extracellular trap formation
    103661038 (AKT2)
   04620 Toll-like receptor signaling pathway
    103661038 (AKT2)
   04625 C-type lectin receptor signaling pathway
    103661038 (AKT2)
   04660 T cell receptor signaling pathway
    103661038 (AKT2)
   04662 B cell receptor signaling pathway
    103661038 (AKT2)
   04664 Fc epsilon RI signaling pathway
    103661038 (AKT2)
   04666 Fc gamma R-mediated phagocytosis
    103661038 (AKT2)
   04062 Chemokine signaling pathway
    103661038 (AKT2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103661038 (AKT2)
   04922 Glucagon signaling pathway
    103661038 (AKT2)
   04923 Regulation of lipolysis in adipocytes
    103661038 (AKT2)
   04920 Adipocytokine signaling pathway
    103661038 (AKT2)
   04929 GnRH secretion
    103661038 (AKT2)
   04915 Estrogen signaling pathway
    103661038 (AKT2)
   04914 Progesterone-mediated oocyte maturation
    103661038 (AKT2)
   04917 Prolactin signaling pathway
    103661038 (AKT2)
   04926 Relaxin signaling pathway
    103661038 (AKT2)
   04935 Growth hormone synthesis, secretion and action
    103661038 (AKT2)
   04919 Thyroid hormone signaling pathway
    103661038 (AKT2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103661038 (AKT2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    103661038 (AKT2)
  09156 Nervous system
   04725 Cholinergic synapse
    103661038 (AKT2)
   04728 Dopaminergic synapse
    103661038 (AKT2)
   04722 Neurotrophin signaling pathway
    103661038 (AKT2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103661038 (AKT2)
  09149 Aging
   04211 Longevity regulating pathway
    103661038 (AKT2)
   04213 Longevity regulating pathway - multiple species
    103661038 (AKT2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103661038 (AKT2)
   05205 Proteoglycans in cancer
    103661038 (AKT2)
   05230 Central carbon metabolism in cancer
    103661038 (AKT2)
   05231 Choline metabolism in cancer
    103661038 (AKT2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103661038 (AKT2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103661038 (AKT2)
   05212 Pancreatic cancer
    103661038 (AKT2)
   05225 Hepatocellular carcinoma
    103661038 (AKT2)
   05226 Gastric cancer
    103661038 (AKT2)
   05214 Glioma
    103661038 (AKT2)
   05221 Acute myeloid leukemia
    103661038 (AKT2)
   05220 Chronic myeloid leukemia
    103661038 (AKT2)
   05218 Melanoma
    103661038 (AKT2)
   05211 Renal cell carcinoma
    103661038 (AKT2)
   05215 Prostate cancer
    103661038 (AKT2)
   05213 Endometrial cancer
    103661038 (AKT2)
   05224 Breast cancer
    103661038 (AKT2)
   05222 Small cell lung cancer
    103661038 (AKT2)
   05223 Non-small cell lung cancer
    103661038 (AKT2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103661038 (AKT2)
   05017 Spinocerebellar ataxia
    103661038 (AKT2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103661038 (AKT2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    103661038 (AKT2)
   04931 Insulin resistance
    103661038 (AKT2)
   04933 AGE-RAGE signaling pathway in diabetic complications
    103661038 (AKT2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103661038 (AKT2)
   05135 Yersinia infection
    103661038 (AKT2)
   05152 Tuberculosis
    103661038 (AKT2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103661038 (AKT2)
   05170 Human immunodeficiency virus 1 infection
    103661038 (AKT2)
   05161 Hepatitis B
    103661038 (AKT2)
   05160 Hepatitis C
    103661038 (AKT2)
   05164 Influenza A
    103661038 (AKT2)
   05162 Measles
    103661038 (AKT2)
   05168 Herpes simplex virus 1 infection
    103661038 (AKT2)
   05163 Human cytomegalovirus infection
    103661038 (AKT2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103661038 (AKT2)
   05169 Epstein-Barr virus infection
    103661038 (AKT2)
   05165 Human papillomavirus infection
    103661038 (AKT2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103661038 (AKT2)
   05142 Chagas disease
    103661038 (AKT2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103661038 (AKT2)
   01524 Platinum drug resistance
    103661038 (AKT2)
   01522 Endocrine resistance
    103661038 (AKT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:umr01001]
    103661038 (AKT2)
Enzymes [BR:umr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     103661038 (AKT2)
Protein kinases [BR:umr01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   103661038 (AKT2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C PH_11
Other DBs
NCBI-GeneID: 103661038
NCBI-ProteinID: XP_008686928
UniProt: A0A384BWG0
LinkDB
Position
Un
AA seq 525 aa
MNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPDAPDQTLPPLNNFSVAEC
QLMKTERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWMRAIQMVANSLKQRGPGEDPM
DYKCGSPSDPSAAEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKASGRYYAM
KILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFH
LSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEG
ISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFE
LILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAREVMEHRFFLSVNWQDVVQK
KLLPPFKPQVTSEVDTRYFDDEFTAQSITITPPDRFFSSALRQTHLSGLSGPASRILSSP
LCPDQNLGDSPLPAPGPGLRAVGEIPVFNQHKPLRGASRGAAGPA
NT seq 1578 nt   +upstreamnt  +downstreamnt
atgaacgaggtgtctgtcatcaaggaaggctggctccacaagcgtggtgaatacatcaag
acctggaggccccggtacttcctgttgaagagtgacggctccttcattggatacaaggag
cggcctgacgcccctgaccagaccctgccccccctgaacaacttctctgtcgcagaatgc
cagctgatgaagaccgagagaccacggcccaacacctttgtcatacgctgcctgcagtgg
accacggtcatcgagaggaccttccacgtagactctccagatgagagggaggagtggatg
cgggccattcagatggttgccaacagcctcaagcagcggggcccaggtgaggaccccatg
gactataagtgtggctcccccagcgacccttctgcagccgaggagatggaagtggcagtt
agcaaggctcgggccaaggtgaccatgaatgacttcgactatctcaaacttctgggcaag
ggcacctttggcaaagtgattctggtgcgggagaaagccagcggccgctactacgccatg
aagatcctgcggaaggaagttatcatcgccaaggatgaagtcgcccacacggtcaccgag
agccgggtcctccagaacaccaggcacccattcctcaccgcactgaagtatgccttccag
acccacgaccgcctgtgcttcgtgatggagtatgccaacggtggtgagctgtttttccac
ctgtcccgggagcgtgtcttcacggaggagcgggctcgcttctacggtgcagagatagtc
tctgccctcgagtatttgcactcgcgggacgtggtgtaccgcgacatcaagctggaaaac
ctcatgctggacaaagatggccacatcaagatcactgacttcggcctgtgcaaagagggc
atcagtgacggggccaccatgaaaaccttctgtgggacacccgagtacctggcacccgag
gtgctggaggacaacgactacggccgcgcggtggactggtgggggctgggcgtggtcatg
tacgagatgatgtgcggccgcctgcctttctacaaccaggaccacgagcgcctcttcgag
ctcatcctcatggaggagatccgcttcccgcgcacgctcagccccgaggccaagtccctg
cttgctgggctgcttaagaaggaccccaagcagaggctcggcggggggcccagcgatgcc
agggaggtcatggagcacaggttcttcctcagcgtcaactggcaggacgtggtacagaag
aagcttctgccccccttcaaacctcaggtcacctccgaggttgacacaaggtactttgac
gatgagtttaccgcccagtccatcacaatcacgcccccggaccgctttttttcttcagcc
ctccgccaaactcacctcagcggtctcagcggccctgcctccaggatcctgtcctcacct
ttgtgcccagaccagaatttgggagactctccactgcccgccccaggaccaggccttcgg
gcggttggagagattccggtttttaatcaacacaagcccctgcgaggggcgtcgcgtgga
gctgcgggtcctgcctga

KEGG   Ursus maritimus (polar bear): 103666688
Entry
103666688         CDS       T03271                                 

Gene name
AKT3
Definition
(RefSeq) AKT serine/threonine kinase 3
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01521  EGFR tyrosine kinase inhibitor resistance
umr01522  Endocrine resistance
umr01524  Platinum drug resistance
umr04010  MAPK signaling pathway
umr04012  ErbB signaling pathway
umr04014  Ras signaling pathway
umr04015  Rap1 signaling pathway
umr04022  cGMP-PKG signaling pathway
umr04024  cAMP signaling pathway
umr04062  Chemokine signaling pathway
umr04066  HIF-1 signaling pathway
umr04068  FoxO signaling pathway
umr04071  Sphingolipid signaling pathway
umr04072  Phospholipase D signaling pathway
umr04140  Autophagy - animal
umr04150  mTOR signaling pathway
umr04151  PI3K-Akt signaling pathway
umr04152  AMPK signaling pathway
umr04210  Apoptosis
umr04211  Longevity regulating pathway
umr04213  Longevity regulating pathway - multiple species
umr04218  Cellular senescence
umr04261  Adrenergic signaling in cardiomyocytes
umr04370  VEGF signaling pathway
umr04371  Apelin signaling pathway
umr04380  Osteoclast differentiation
umr04510  Focal adhesion
umr04550  Signaling pathways regulating pluripotency of stem cells
umr04611  Platelet activation
umr04613  Neutrophil extracellular trap formation
umr04620  Toll-like receptor signaling pathway
umr04625  C-type lectin receptor signaling pathway
umr04630  JAK-STAT signaling pathway
umr04660  T cell receptor signaling pathway
umr04662  B cell receptor signaling pathway
umr04664  Fc epsilon RI signaling pathway
umr04666  Fc gamma R-mediated phagocytosis
umr04668  TNF signaling pathway
umr04722  Neurotrophin signaling pathway
umr04725  Cholinergic synapse
umr04728  Dopaminergic synapse
umr04910  Insulin signaling pathway
umr04914  Progesterone-mediated oocyte maturation
umr04915  Estrogen signaling pathway
umr04917  Prolactin signaling pathway
umr04919  Thyroid hormone signaling pathway
umr04920  Adipocytokine signaling pathway
umr04922  Glucagon signaling pathway
umr04923  Regulation of lipolysis in adipocytes
umr04926  Relaxin signaling pathway
umr04929  GnRH secretion
umr04931  Insulin resistance
umr04932  Non-alcoholic fatty liver disease
umr04933  AGE-RAGE signaling pathway in diabetic complications
umr04935  Growth hormone synthesis, secretion and action
umr04973  Carbohydrate digestion and absorption
umr05010  Alzheimer disease
umr05017  Spinocerebellar ataxia
umr05132  Salmonella infection
umr05135  Yersinia infection
umr05142  Chagas disease
umr05145  Toxoplasmosis
umr05152  Tuberculosis
umr05160  Hepatitis C
umr05161  Hepatitis B
umr05162  Measles
umr05163  Human cytomegalovirus infection
umr05164  Influenza A
umr05165  Human papillomavirus infection
umr05166  Human T-cell leukemia virus 1 infection
umr05167  Kaposi sarcoma-associated herpesvirus infection
umr05168  Herpes simplex virus 1 infection
umr05169  Epstein-Barr virus infection
umr05170  Human immunodeficiency virus 1 infection
umr05200  Pathways in cancer
umr05205  Proteoglycans in cancer
umr05210  Colorectal cancer
umr05211  Renal cell carcinoma
umr05212  Pancreatic cancer
umr05213  Endometrial cancer
umr05214  Glioma
umr05215  Prostate cancer
umr05218  Melanoma
umr05220  Chronic myeloid leukemia
umr05221  Acute myeloid leukemia
umr05222  Small cell lung cancer
umr05223  Non-small cell lung cancer
umr05224  Breast cancer
umr05225  Hepatocellular carcinoma
umr05226  Gastric cancer
umr05230  Central carbon metabolism in cancer
umr05231  Choline metabolism in cancer
umr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
umr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103666688 (AKT3)
   04012 ErbB signaling pathway
    103666688 (AKT3)
   04014 Ras signaling pathway
    103666688 (AKT3)
   04015 Rap1 signaling pathway
    103666688 (AKT3)
   04370 VEGF signaling pathway
    103666688 (AKT3)
   04371 Apelin signaling pathway
    103666688 (AKT3)
   04630 JAK-STAT signaling pathway
    103666688 (AKT3)
   04668 TNF signaling pathway
    103666688 (AKT3)
   04066 HIF-1 signaling pathway
    103666688 (AKT3)
   04068 FoxO signaling pathway
    103666688 (AKT3)
   04072 Phospholipase D signaling pathway
    103666688 (AKT3)
   04071 Sphingolipid signaling pathway
    103666688 (AKT3)
   04024 cAMP signaling pathway
    103666688 (AKT3)
   04022 cGMP-PKG signaling pathway
    103666688 (AKT3)
   04151 PI3K-Akt signaling pathway
    103666688 (AKT3)
   04152 AMPK signaling pathway
    103666688 (AKT3)
   04150 mTOR signaling pathway
    103666688 (AKT3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103666688 (AKT3)
  09143 Cell growth and death
   04210 Apoptosis
    103666688 (AKT3)
   04218 Cellular senescence
    103666688 (AKT3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103666688 (AKT3)
   04550 Signaling pathways regulating pluripotency of stem cells
    103666688 (AKT3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103666688 (AKT3)
   04613 Neutrophil extracellular trap formation
    103666688 (AKT3)
   04620 Toll-like receptor signaling pathway
    103666688 (AKT3)
   04625 C-type lectin receptor signaling pathway
    103666688 (AKT3)
   04660 T cell receptor signaling pathway
    103666688 (AKT3)
   04662 B cell receptor signaling pathway
    103666688 (AKT3)
   04664 Fc epsilon RI signaling pathway
    103666688 (AKT3)
   04666 Fc gamma R-mediated phagocytosis
    103666688 (AKT3)
   04062 Chemokine signaling pathway
    103666688 (AKT3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103666688 (AKT3)
   04922 Glucagon signaling pathway
    103666688 (AKT3)
   04923 Regulation of lipolysis in adipocytes
    103666688 (AKT3)
   04920 Adipocytokine signaling pathway
    103666688 (AKT3)
   04929 GnRH secretion
    103666688 (AKT3)
   04915 Estrogen signaling pathway
    103666688 (AKT3)
   04914 Progesterone-mediated oocyte maturation
    103666688 (AKT3)
   04917 Prolactin signaling pathway
    103666688 (AKT3)
   04926 Relaxin signaling pathway
    103666688 (AKT3)
   04935 Growth hormone synthesis, secretion and action
    103666688 (AKT3)
   04919 Thyroid hormone signaling pathway
    103666688 (AKT3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103666688 (AKT3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    103666688 (AKT3)
  09156 Nervous system
   04725 Cholinergic synapse
    103666688 (AKT3)
   04728 Dopaminergic synapse
    103666688 (AKT3)
   04722 Neurotrophin signaling pathway
    103666688 (AKT3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103666688 (AKT3)
  09149 Aging
   04211 Longevity regulating pathway
    103666688 (AKT3)
   04213 Longevity regulating pathway - multiple species
    103666688 (AKT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103666688 (AKT3)
   05205 Proteoglycans in cancer
    103666688 (AKT3)
   05230 Central carbon metabolism in cancer
    103666688 (AKT3)
   05231 Choline metabolism in cancer
    103666688 (AKT3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103666688 (AKT3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103666688 (AKT3)
   05212 Pancreatic cancer
    103666688 (AKT3)
   05225 Hepatocellular carcinoma
    103666688 (AKT3)
   05226 Gastric cancer
    103666688 (AKT3)
   05214 Glioma
    103666688 (AKT3)
   05221 Acute myeloid leukemia
    103666688 (AKT3)
   05220 Chronic myeloid leukemia
    103666688 (AKT3)
   05218 Melanoma
    103666688 (AKT3)
   05211 Renal cell carcinoma
    103666688 (AKT3)
   05215 Prostate cancer
    103666688 (AKT3)
   05213 Endometrial cancer
    103666688 (AKT3)
   05224 Breast cancer
    103666688 (AKT3)
   05222 Small cell lung cancer
    103666688 (AKT3)
   05223 Non-small cell lung cancer
    103666688 (AKT3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103666688 (AKT3)
   05017 Spinocerebellar ataxia
    103666688 (AKT3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103666688 (AKT3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    103666688 (AKT3)
   04931 Insulin resistance
    103666688 (AKT3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    103666688 (AKT3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103666688 (AKT3)
   05135 Yersinia infection
    103666688 (AKT3)
   05152 Tuberculosis
    103666688 (AKT3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103666688 (AKT3)
   05170 Human immunodeficiency virus 1 infection
    103666688 (AKT3)
   05161 Hepatitis B
    103666688 (AKT3)
   05160 Hepatitis C
    103666688 (AKT3)
   05164 Influenza A
    103666688 (AKT3)
   05162 Measles
    103666688 (AKT3)
   05168 Herpes simplex virus 1 infection
    103666688 (AKT3)
   05163 Human cytomegalovirus infection
    103666688 (AKT3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103666688 (AKT3)
   05169 Epstein-Barr virus infection
    103666688 (AKT3)
   05165 Human papillomavirus infection
    103666688 (AKT3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103666688 (AKT3)
   05142 Chagas disease
    103666688 (AKT3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103666688 (AKT3)
   01524 Platinum drug resistance
    103666688 (AKT3)
   01522 Endocrine resistance
    103666688 (AKT3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:umr01001]
    103666688 (AKT3)
Enzymes [BR:umr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     103666688 (AKT3)
Protein kinases [BR:umr01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   103666688 (AKT3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like FTA2 PH_11
Other DBs
NCBI-GeneID: 103666688
NCBI-ProteinID: XP_008692992
UniProt: A0A384CDT1
LinkDB
Position
Un
AA seq 479 aa
MSDVTVVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDVDLPYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPEEREEWTEAIQAVADRLQRQEEERMNCS
PTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILK
KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRE
RVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDA
ATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILM
EDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGVNWQDVYDKKLVP
PFKPQVTSETDTRYFDEEFTAQTITITPPEKYDEDGMDCVDNERRPHFPQFSYSASGRE
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgagcgatgttaccgtcgtgaaagaaggctgggttcagaagaggggagaatatataaaa
aactggaggccaagatatttccttttgaagacagatggctcattcataggatataaagag
aaacctcaagatgtggatttaccttatcccctcaacaacttttcagtggcaaaatgccag
ttaatgaaaacagaacgaccaaagccaaacacatttattatcagatgtctccagtggacc
actgttatagagagaacgtttcatgtagatactccagaggaaagggaagagtggacagaa
gctattcaggctgtagcagacagacttcagagacaagaagaggagagaatgaattgtagt
ccaacttcacaaattgataatataggggaggaagagatggatgcttccacaacccatcat
aaaagaaagacaatgaatgattttgactatttgaaactgctaggtaaaggcacttttggg
aaagttattttggttcgagagaaggcaagtgggaaatactatgctatgaagattctgaag
aaagaagttattattgcaaaggatgaagtggcgcatactctaacggaaagcagagtatta
aagaacactagacatccctttttaacatccttgaaatattccttccagacaaaagaccgt
ttgtgttttgtgatggaatatgtaaatgggggagagctgtttttccatttgtcgagagag
cgggtgttctccgaggaccgcacacgtttctatggtgcagaaattgtctctgctttggac
tatctacattccggaaagattgtgtaccgtgatctcaagttggagaatttgatgctggat
aaagatggccacataaaaatcacagactttgggctttgcaaagaagggatcacggacgcg
gccaccatgaagacgttctgtggcacaccggagtacctggcacctgaggtgttagaagac
aacgactatggccgagccgtggattggtggggcctgggggtcgtcatgtatgagatgatg
tgtgggaggctacctttctacaaccaggatcatgagaaactttttgaactaatactaatg
gaagacattaaatttcctcgaacactctcttcagatgcaaaatcactgctttcagggctc
ttgataaaggatccaaataagcgccttggcgggggcccagatgatgcaaaagaaattatg
aggcacagtttcttctctggagtcaactggcaagatgtatacgataaaaagcttgtacct
ccttttaagcctcaagtaacatctgagacagataccagatattttgatgaagaatttaca
gctcagactattacaataacgccacctgaaaaatatgacgaggacggcatggactgcgtg
gacaacgagcggcggccacacttccctcagttctcctactctgccagcggccgcgagtaa

KEGG   Ursus maritimus (polar bear): 103676878
Entry
103676878         CDS       T03271                                 

Gene name
AKT1
Definition
(RefSeq) AKT serine/threonine kinase 1
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01521  EGFR tyrosine kinase inhibitor resistance
umr01522  Endocrine resistance
umr01524  Platinum drug resistance
umr04010  MAPK signaling pathway
umr04012  ErbB signaling pathway
umr04014  Ras signaling pathway
umr04015  Rap1 signaling pathway
umr04022  cGMP-PKG signaling pathway
umr04024  cAMP signaling pathway
umr04062  Chemokine signaling pathway
umr04066  HIF-1 signaling pathway
umr04068  FoxO signaling pathway
umr04071  Sphingolipid signaling pathway
umr04072  Phospholipase D signaling pathway
umr04140  Autophagy - animal
umr04150  mTOR signaling pathway
umr04151  PI3K-Akt signaling pathway
umr04152  AMPK signaling pathway
umr04210  Apoptosis
umr04211  Longevity regulating pathway
umr04213  Longevity regulating pathway - multiple species
umr04218  Cellular senescence
umr04261  Adrenergic signaling in cardiomyocytes
umr04370  VEGF signaling pathway
umr04371  Apelin signaling pathway
umr04380  Osteoclast differentiation
umr04510  Focal adhesion
umr04550  Signaling pathways regulating pluripotency of stem cells
umr04611  Platelet activation
umr04613  Neutrophil extracellular trap formation
umr04620  Toll-like receptor signaling pathway
umr04625  C-type lectin receptor signaling pathway
umr04630  JAK-STAT signaling pathway
umr04660  T cell receptor signaling pathway
umr04662  B cell receptor signaling pathway
umr04664  Fc epsilon RI signaling pathway
umr04666  Fc gamma R-mediated phagocytosis
umr04668  TNF signaling pathway
umr04722  Neurotrophin signaling pathway
umr04725  Cholinergic synapse
umr04728  Dopaminergic synapse
umr04910  Insulin signaling pathway
umr04914  Progesterone-mediated oocyte maturation
umr04915  Estrogen signaling pathway
umr04917  Prolactin signaling pathway
umr04919  Thyroid hormone signaling pathway
umr04920  Adipocytokine signaling pathway
umr04922  Glucagon signaling pathway
umr04923  Regulation of lipolysis in adipocytes
umr04926  Relaxin signaling pathway
umr04929  GnRH secretion
umr04931  Insulin resistance
umr04932  Non-alcoholic fatty liver disease
umr04933  AGE-RAGE signaling pathway in diabetic complications
umr04935  Growth hormone synthesis, secretion and action
umr04973  Carbohydrate digestion and absorption
umr05010  Alzheimer disease
umr05017  Spinocerebellar ataxia
umr05132  Salmonella infection
umr05135  Yersinia infection
umr05142  Chagas disease
umr05145  Toxoplasmosis
umr05152  Tuberculosis
umr05160  Hepatitis C
umr05161  Hepatitis B
umr05162  Measles
umr05163  Human cytomegalovirus infection
umr05164  Influenza A
umr05165  Human papillomavirus infection
umr05166  Human T-cell leukemia virus 1 infection
umr05167  Kaposi sarcoma-associated herpesvirus infection
umr05168  Herpes simplex virus 1 infection
umr05169  Epstein-Barr virus infection
umr05170  Human immunodeficiency virus 1 infection
umr05200  Pathways in cancer
umr05205  Proteoglycans in cancer
umr05210  Colorectal cancer
umr05211  Renal cell carcinoma
umr05212  Pancreatic cancer
umr05213  Endometrial cancer
umr05214  Glioma
umr05215  Prostate cancer
umr05218  Melanoma
umr05220  Chronic myeloid leukemia
umr05221  Acute myeloid leukemia
umr05222  Small cell lung cancer
umr05223  Non-small cell lung cancer
umr05224  Breast cancer
umr05225  Hepatocellular carcinoma
umr05226  Gastric cancer
umr05230  Central carbon metabolism in cancer
umr05231  Choline metabolism in cancer
umr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
umr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103676878 (AKT1)
   04012 ErbB signaling pathway
    103676878 (AKT1)
   04014 Ras signaling pathway
    103676878 (AKT1)
   04015 Rap1 signaling pathway
    103676878 (AKT1)
   04370 VEGF signaling pathway
    103676878 (AKT1)
   04371 Apelin signaling pathway
    103676878 (AKT1)
   04630 JAK-STAT signaling pathway
    103676878 (AKT1)
   04668 TNF signaling pathway
    103676878 (AKT1)
   04066 HIF-1 signaling pathway
    103676878 (AKT1)
   04068 FoxO signaling pathway
    103676878 (AKT1)
   04072 Phospholipase D signaling pathway
    103676878 (AKT1)
   04071 Sphingolipid signaling pathway
    103676878 (AKT1)
   04024 cAMP signaling pathway
    103676878 (AKT1)
   04022 cGMP-PKG signaling pathway
    103676878 (AKT1)
   04151 PI3K-Akt signaling pathway
    103676878 (AKT1)
   04152 AMPK signaling pathway
    103676878 (AKT1)
   04150 mTOR signaling pathway
    103676878 (AKT1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103676878 (AKT1)
  09143 Cell growth and death
   04210 Apoptosis
    103676878 (AKT1)
   04218 Cellular senescence
    103676878 (AKT1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103676878 (AKT1)
   04550 Signaling pathways regulating pluripotency of stem cells
    103676878 (AKT1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103676878 (AKT1)
   04613 Neutrophil extracellular trap formation
    103676878 (AKT1)
   04620 Toll-like receptor signaling pathway
    103676878 (AKT1)
   04625 C-type lectin receptor signaling pathway
    103676878 (AKT1)
   04660 T cell receptor signaling pathway
    103676878 (AKT1)
   04662 B cell receptor signaling pathway
    103676878 (AKT1)
   04664 Fc epsilon RI signaling pathway
    103676878 (AKT1)
   04666 Fc gamma R-mediated phagocytosis
    103676878 (AKT1)
   04062 Chemokine signaling pathway
    103676878 (AKT1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103676878 (AKT1)
   04922 Glucagon signaling pathway
    103676878 (AKT1)
   04923 Regulation of lipolysis in adipocytes
    103676878 (AKT1)
   04920 Adipocytokine signaling pathway
    103676878 (AKT1)
   04929 GnRH secretion
    103676878 (AKT1)
   04915 Estrogen signaling pathway
    103676878 (AKT1)
   04914 Progesterone-mediated oocyte maturation
    103676878 (AKT1)
   04917 Prolactin signaling pathway
    103676878 (AKT1)
   04926 Relaxin signaling pathway
    103676878 (AKT1)
   04935 Growth hormone synthesis, secretion and action
    103676878 (AKT1)
   04919 Thyroid hormone signaling pathway
    103676878 (AKT1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103676878 (AKT1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    103676878 (AKT1)
  09156 Nervous system
   04725 Cholinergic synapse
    103676878 (AKT1)
   04728 Dopaminergic synapse
    103676878 (AKT1)
   04722 Neurotrophin signaling pathway
    103676878 (AKT1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103676878 (AKT1)
  09149 Aging
   04211 Longevity regulating pathway
    103676878 (AKT1)
   04213 Longevity regulating pathway - multiple species
    103676878 (AKT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103676878 (AKT1)
   05205 Proteoglycans in cancer
    103676878 (AKT1)
   05230 Central carbon metabolism in cancer
    103676878 (AKT1)
   05231 Choline metabolism in cancer
    103676878 (AKT1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103676878 (AKT1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103676878 (AKT1)
   05212 Pancreatic cancer
    103676878 (AKT1)
   05225 Hepatocellular carcinoma
    103676878 (AKT1)
   05226 Gastric cancer
    103676878 (AKT1)
   05214 Glioma
    103676878 (AKT1)
   05221 Acute myeloid leukemia
    103676878 (AKT1)
   05220 Chronic myeloid leukemia
    103676878 (AKT1)
   05218 Melanoma
    103676878 (AKT1)
   05211 Renal cell carcinoma
    103676878 (AKT1)
   05215 Prostate cancer
    103676878 (AKT1)
   05213 Endometrial cancer
    103676878 (AKT1)
   05224 Breast cancer
    103676878 (AKT1)
   05222 Small cell lung cancer
    103676878 (AKT1)
   05223 Non-small cell lung cancer
    103676878 (AKT1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103676878 (AKT1)
   05017 Spinocerebellar ataxia
    103676878 (AKT1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103676878 (AKT1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    103676878 (AKT1)
   04931 Insulin resistance
    103676878 (AKT1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    103676878 (AKT1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103676878 (AKT1)
   05135 Yersinia infection
    103676878 (AKT1)
   05152 Tuberculosis
    103676878 (AKT1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103676878 (AKT1)
   05170 Human immunodeficiency virus 1 infection
    103676878 (AKT1)
   05161 Hepatitis B
    103676878 (AKT1)
   05160 Hepatitis C
    103676878 (AKT1)
   05164 Influenza A
    103676878 (AKT1)
   05162 Measles
    103676878 (AKT1)
   05168 Herpes simplex virus 1 infection
    103676878 (AKT1)
   05163 Human cytomegalovirus infection
    103676878 (AKT1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103676878 (AKT1)
   05169 Epstein-Barr virus infection
    103676878 (AKT1)
   05165 Human papillomavirus infection
    103676878 (AKT1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103676878 (AKT1)
   05142 Chagas disease
    103676878 (AKT1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103676878 (AKT1)
   01524 Platinum drug resistance
    103676878 (AKT1)
   01522 Endocrine resistance
    103676878 (AKT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:umr01001]
    103676878 (AKT1)
Enzymes [BR:umr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     103676878 (AKT1)
Protein kinases [BR:umr01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   103676878 (AKT1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like PH_11 Seadorna_VP7 Pkinase_fungal APH
Other DBs
NCBI-GeneID: 103676878
NCBI-ProteinID: XP_008704315
UniProt: A0A384DC20
LinkDB
Position
Un
AA seq 515 aa
MVGERMSSSTCHPSAGHGADASSQPHLPSEPCLQEDPVTAALGEAPSRGAGEYIKTWRPR
YFLLKNDGTFIGYKERPQDVEQRESPLNNFSVAQCQLMKTERPRPNTFIIRCLQWTTVIE
RTFHVETPEEREEWTTAIQTVADGLKRQEEEMMDFRSGSPSDNSGAEEMEVSLAKPKHRV
TMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKILKKEVIVAKDEVAHTLTENRVLQNS
RHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLSRERVFPEDRARFYGAEIVSALDYLH
SEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGIKDGATMKTFCGTPEYLAPEVLEDND
YGRAVDWWGLGVVMYEMLCGRLPFYNQDHEKLFELILMEELRFPRTLSPEAKSLLSGLLK
KDPKQRLGGGSDDAKEIMQHRFFASIVWQDVYEKKLSPPFKPQVTSETDTRYFDEEFTAQ
MITITPPDQGDNMEGEDSERRPHFPQFSYSASGTA
NT seq 1548 nt   +upstreamnt  +downstreamnt
atggtaggggagcgtatgtcctcctccacatgtcacccctctgctgggcacggagcggat
gcctcctcccagccacacctgccgtccgagccctgcctccaggaggaccccgtgactgct
gccctcggagaggctccgtctcgaggagcaggggagtacatcaaaacctggcggccccgc
tacttcctcctcaagaatgacggcaccttcatcggctacaaggagcggccccaggatgtc
gagcagcgagagtcccctctcaacaacttctctgtggctcaatgtcagctgatgaagacg
gagcggccccggcccaacaccttcatcatccgctgcctgcagtggaccacggtgatcgag
cgcaccttccacgtggagacacccgaggagcgggaggagtggacaactgccatccagacg
gtggccgacgggctcaagaggcaggaggaagagatgatggacttccggtcgggctcaccg
agcgacaactccggcgccgaggagatggaggtgtccctggccaagcccaagcaccgtgtg
accatgaacgagtttgagtacttgaagctgctgggcaagggcacgtttgggaaggtgatt
ctggtgaaggagaaggccacgggccgctactacgccatgaagatcctgaagaaggaggtc
attgtggccaaggacgaggttgcccacacgctcacggagaaccgtgttctgcagaactcg
aggcatcccttcctgacggccctgaagtactcctttcagacccacgaccgcctctgcttc
gtcatggagtacgccaacgggggtgagctcttcttccacctgtcccgggagcgcgtgttc
cctgaggaccgggcccgcttctacggtgccgagatcgtgtctgccttggactacctgcac
tcggagaagaacgtggtttaccgcgacctcaagctggagaacctcatgctggataaggac
gggcacatcaagatcacggactttggcctgtgcaaggagggcatcaaggacggggccacc
atgaagaccttctgcgggacgcccgagtacctggcccccgaggtgctggaggacaatgac
tacggccgggcggtggactggtgggggctgggcgtggtcatgtacgagatgctgtgtggc
cggctgcccttctacaaccaggaccacgagaagctcttcgaactcatcctcatggaggag
ctccgcttcccgcgcacgctcagccctgaggccaagtccctgctctcggggctgctcaag
aaggaccccaagcagaggctcggagggggctcagacgacgccaaggagatcatgcagcac
cgcttcttcgctagcatcgtgtggcaggacgtgtacgagaagaagctcagtccacccttc
aagccccaggtcacatcagagacagacaccaggtattttgatgaggagttcacggctcag
atgatcaccatcacgccacccgaccaaggtgacaacatggagggggaggacagcgagcgg
aggccccacttcccgcagttctcctactcggccagtggcacagcctga

DBGET integrated database retrieval system