KEGG   Ursus maritimus (polar bear): 103661798
Entry
103661798         CDS       T03271                                 

Gene name
CCNA2
Definition
(RefSeq) cyclin A2
  KO
K06627  cyclin-A
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04110  Cell cycle
umr04152  AMPK signaling pathway
umr04218  Cellular senescence
umr04914  Progesterone-mediated oocyte maturation
umr05161  Hepatitis B
umr05165  Human papillomavirus infection
umr05166  Human T-cell leukemia virus 1 infection
umr05169  Epstein-Barr virus infection
umr05200  Pathways in cancer
umr05202  Transcriptional misregulation in cancer
umr05203  Viral carcinogenesis
umr05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    103661798 (CCNA2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103661798 (CCNA2)
   04218 Cellular senescence
    103661798 (CCNA2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    103661798 (CCNA2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103661798 (CCNA2)
   05202 Transcriptional misregulation in cancer
    103661798 (CCNA2)
   05203 Viral carcinogenesis
    103661798 (CCNA2)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    103661798 (CCNA2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103661798 (CCNA2)
   05161 Hepatitis B
    103661798 (CCNA2)
   05169 Epstein-Barr virus infection
    103661798 (CCNA2)
   05165 Human papillomavirus infection
    103661798 (CCNA2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:umr03032]
    103661798 (CCNA2)
   03036 Chromosome and associated proteins [BR:umr03036]
    103661798 (CCNA2)
DNA replication proteins [BR:umr03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    103661798 (CCNA2)
Chromosome and associated proteins [BR:umr03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    103661798 (CCNA2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_N2 Cyclin_C Sororin
Other DBs
NCBI-GeneID: 103661798
NCBI-ProteinID: XP_008687705
UniProt: A0A384BZX3
LinkDB
Position
Un
AA seq 427 aa
MLGSSEPGPAAREAGSSLLTLPHTALQEDQENINPEKAAPAQQPRTRAGLGVLFVPAPQQ
RPKTRRVAPLKDLPINDEHVTVPPWKANSKQPAFTIHVDEAEEETQKRPAESKNTEHENV
LAFNSAITLPGPRKPLVPLDYPMDGSFESPHTMDISIVLEDEKPLSVNEVPDYHEDIHTY
LREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSS
MSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLAFD
LAAPTVNQFLTQYFLHQQSANCKVESLAMFLGELSLIDADPYLKYLPSVIAAAAFHLALY
TVTGQSWPESLVQKTGYTLESLKPCLMDLHQTYLRAPQHAQQSIREKYKSSKYHGVSLLN
PPETLNV
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgttgggcagctccgagcccgggcctgcggcccgcgaggcgggctcgtcgctgctaaca
ttgccgcatacggcgctccaagaggaccaggagaacatcaaccccgagaaggcggcgccc
gcccagcagccccggacccgggccgggctgggggtactgtttgttccggcgccgcagcag
aggcccaagacacgacgggttgcacctcttaaggatcttcctataaatgatgaacatgtc
actgttcctccctggaaagcaaacagtaaacagcctgcatttaccattcatgtggatgaa
gcagaagaagagactcagaagaggccagctgaatctaaaaacacagagcatgaaaatgtc
ctggcttttaattcagctattactttacctggaccaagaaaaccactggtacctcttgat
tatccaatggatggtagttttgagtcaccacatactatggacatatcaattgtattagaa
gatgaaaagccattgagtgtcaatgaagtcccagactaccatgaggacattcacacatac
cttagggaaatggaggttaaatgtaagcctaaagtgggttacatgaagaaacagccagac
atcactaacagtatgagggctatccttgtggactggttagttgaagtaggagaagaatat
aaactacagaatgagaccctgcacttggctgtgaactacattgataggttcctttcatcg
atgtctgtgttgagaggaaaacttcagcttgtgggcactgctgctatgctgttggcctca
aagtttgaagaaatataccccccagaagtagcagagtttgtgtacattacagatgatacc
tataccaagaaacaggtcctgagaatggagcacctagttttgaaagtgcttgcttttgac
ctagctgcaccaacagtaaatcagtttcttacccaatactttctgcaccagcagtctgcc
aactgcaaagttgaaagtttagcaatgtttttgggagaattaagtctgatagatgctgac
ccctacctgaagtatctgccatcagttattgctgcagcggcttttcatttagcactctac
acagtcacaggacagagctggcctgaatctttagttcaaaagactggatataccttggaa
agtcttaagccttgtctcatggaccttcaccagacctacctcagagcaccacagcacgca
caacagtcaataagagaaaagtacaaaagttcaaagtatcatggtgtttctctcctcaac
ccaccagagacactaaatgtgtaa

KEGG   Ursus maritimus (polar bear): 103664372
Entry
103664372         CDS       T03271                                 

Gene name
CCNA1
Definition
(RefSeq) cyclin A1
  KO
K06627  cyclin-A
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04110  Cell cycle
umr04152  AMPK signaling pathway
umr04218  Cellular senescence
umr04914  Progesterone-mediated oocyte maturation
umr05161  Hepatitis B
umr05165  Human papillomavirus infection
umr05166  Human T-cell leukemia virus 1 infection
umr05169  Epstein-Barr virus infection
umr05200  Pathways in cancer
umr05202  Transcriptional misregulation in cancer
umr05203  Viral carcinogenesis
umr05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    103664372 (CCNA1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103664372 (CCNA1)
   04218 Cellular senescence
    103664372 (CCNA1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    103664372 (CCNA1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103664372 (CCNA1)
   05202 Transcriptional misregulation in cancer
    103664372 (CCNA1)
   05203 Viral carcinogenesis
    103664372 (CCNA1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    103664372 (CCNA1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103664372 (CCNA1)
   05161 Hepatitis B
    103664372 (CCNA1)
   05169 Epstein-Barr virus infection
    103664372 (CCNA1)
   05165 Human papillomavirus infection
    103664372 (CCNA1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:umr03032]
    103664372 (CCNA1)
   03036 Chromosome and associated proteins [BR:umr03036]
    103664372 (CCNA1)
DNA replication proteins [BR:umr03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    103664372 (CCNA1)
Chromosome and associated proteins [BR:umr03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    103664372 (CCNA1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C Cyclin_N2
Other DBs
NCBI-GeneID: 103664372
NCBI-ProteinID: XP_008690457
UniProt: A0A384C6L2
LinkDB
Position
Un
AA seq 419 aa
MHCSSSKRGVALAPVPRGPDACQMITRAQLGQDLPQRTVLGVLTENGQYRRTCCQGITTI
RCFSGSENVFPPAGKKVLSDCMVQVPAKQGFDIYMDEPDQGDRDSCTGKKXFEDVYEVDT
STLKSDLHFLLDFNTVSPMVVDSSLHSQSEDASDFGTDVINVTEYAEEIHQYLREAEIRH
RPKAHYMRKQPDITEGMRMILVDWLVEVGEEYKLRAETLYLAVNFLDRFLSCMSVLRGKL
QLVGTAAILLASKYEEIYPPEVDEFVYITDDTYTKRQLLRMEHLLLKVLAFDLTVPTTNQ
FLLQYLRRQGVCVRTENLAKYVAELSLLEADPFLKYLPSLIAAAAYCLANYTVNRHFWPE
TLAAFTGYSLNEIVPCLSELHKACLDIPHRPQQAIREKYKASKYMHVSLMEPPAVLPLQ
NT seq 1260 nt   +upstreamnt  +downstreamnt
atgcattgcagcagctccaagaggggagtcgccctagctccagtgcctcgaggtcctgat
gcctgtcagatgataaccagagcccagctcggccaggatctcccacagagaaccgtgcta
ggggtgctaactgagaatgggcagtacaggaggacctgttgccaggggatcacaacaatc
aggtgtttctctggatcagaaaatgtcttccctccagccggaaagaaggtgctctctgac
tgcatggtccaggtgccagccaagcaaggatttgacatctacatggatgagcctgatcag
ggggacagagacagctgcacagggaaaaaancatttgaggatgtgtatgaggtagacacc
agcacactcaagtcagaccttcacttcctgctggattttaacacagtttctccaatggtg
gtagattcatctctccattcccagtctgaagatgcatcagattttggtacagatgtgata
aacgtgactgaatatgctgaagaaattcatcagtaccttagagaagctgaaataagacac
aggcccaaagcacactacatgaggaagcaaccagacatcacggaaggcatgcgaatgatt
ctggtggactggcttgttgaggtcggtgaagagtataagcttcgagcagagactctctac
ctggctgtcaacttcctggacaggtttctttcatgcatgtctgttctgagagggaaactg
cagcttgtaggaacagcagctattcttctagcttcgaaatatgaagaaatatatccaccc
gaagtagacgagtttgtctacataactgatgatacttacacaaaacgccaactgctaaga
atggaacacttgctcctgaaagttctggcgtttgatctcacagtgccaaccaccaaccag
tttctccttcagtacttaaggagacaaggagtgtgcgtcagaactgagaatctggccaag
tatgtagcagaactgagtctacttgaagctgacccattcttgaaatatcttccttcattg
atagctgcagcagcttattgcctggcaaactatactgtgaacaggcacttctggccagaa
acccttgctgcatttacaggctattcattaaatgaaattgtgccttgcctgagtgagcta
cataaagcatgccttgatataccccatcgacctcaacaagcaattagggagaagtataag
gcttcaaagtacatgcacgtgtctctgatggaaccacctgcggttctccctctgcaataa

DBGET integrated database retrieval system