KEGG   Ursus maritimus (polar bear): 103661804
Entry
103661804         CDS       T03271                                 

Gene name
IL2
Definition
(RefSeq) interleukin 2
  KO
K05429  interleukin 2
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04060  Cytokine-cytokine receptor interaction
umr04061  Viral protein interaction with cytokine and cytokine receptor
umr04151  PI3K-Akt signaling pathway
umr04625  C-type lectin receptor signaling pathway
umr04630  JAK-STAT signaling pathway
umr04658  Th1 and Th2 cell differentiation
umr04659  Th17 cell differentiation
umr04660  T cell receptor signaling pathway
umr04672  Intestinal immune network for IgA production
umr04940  Type I diabetes mellitus
umr05135  Yersinia infection
umr05142  Chagas disease
umr05162  Measles
umr05166  Human T-cell leukemia virus 1 infection
umr05200  Pathways in cancer
umr05320  Autoimmune thyroid disease
umr05321  Inflammatory bowel disease
umr05330  Allograft rejection
umr05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103661804 (IL2)
   04151 PI3K-Akt signaling pathway
    103661804 (IL2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103661804 (IL2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    103661804 (IL2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    103661804 (IL2)
   04660 T cell receptor signaling pathway
    103661804 (IL2)
   04658 Th1 and Th2 cell differentiation
    103661804 (IL2)
   04659 Th17 cell differentiation
    103661804 (IL2)
   04672 Intestinal immune network for IgA production
    103661804 (IL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103661804 (IL2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    103661804 (IL2)
   05321 Inflammatory bowel disease
    103661804 (IL2)
   05330 Allograft rejection
    103661804 (IL2)
   05332 Graft-versus-host disease
    103661804 (IL2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    103661804 (IL2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    103661804 (IL2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103661804 (IL2)
   05162 Measles
    103661804 (IL2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    103661804 (IL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:umr04052]
    103661804 (IL2)
   00536 Glycosaminoglycan binding proteins [BR:umr00536]
    103661804 (IL2)
Cytokines and growth factors [BR:umr04052]
 Cytokines
  Interleukins
   103661804 (IL2)
Glycosaminoglycan binding proteins [BR:umr00536]
 Heparan sulfate / Haparin
  Cytokines
   103661804 (IL2)
SSDB
Motif
Pfam: IL2
Other DBs
NCBI-GeneID: 103661804
NCBI-ProteinID: XP_008687711
UniProt: A0A384BYP6
LinkDB
Position
Un
AA seq 155 aa
MYKMQLLYCIALTLVLLANSAPTTSSPTKETQQQLEQLLLDLRLLLNGVNNYENPKLSRM
LTFKFYMPKKATELKHLQCLAEELKLLEEVLYLDQSKNLHLTDIKELMSNINVTLLKLKG
SEASFKCEYDDETVTITEFLNKWITFCQSIFSTLT
NT seq 468 nt   +upstreamnt  +downstreamnt
atgtacaaaatgcaactcttgtattgcatcgcactgactcttgtactcctcgcaaacagt
gcacctactacttcaagccctacgaaggaaacacagcaacagctggagcaattgctgctg
gatttacggttgctcttgaatggagttaataattatgagaaccccaaactctccaggatg
ctcacgtttaaattctacatgcccaagaaggccacagaattgaaacatcttcaatgtcta
gcagaagaactcaaacttctggaggaagtgctatatttagatcaaagcaaaaaccttcac
ttgacagacatcaaggaattaatgagcaatatcaatgtaacacttctgaaactaaaggga
tcagaagcaagtttcaaatgtgaatatgatgacgagacagtaaccattacagaatttctg
aacaaatggattactttttgtcaaagcatcttctcaacactgacttga

DBGET integrated database retrieval system