KEGG   Ursus maritimus (polar bear): 103661934
Entry
103661934         CDS       T03271                                 

Gene name
FAS
Definition
(RefSeq) Fas cell surface death receptor
  KO
K04390  tumor necrosis factor receptor superfamily member 6
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01524  Platinum drug resistance
umr04010  MAPK signaling pathway
umr04060  Cytokine-cytokine receptor interaction
umr04115  p53 signaling pathway
umr04210  Apoptosis
umr04217  Necroptosis
umr04650  Natural killer cell mediated cytotoxicity
umr04668  TNF signaling pathway
umr04932  Non-alcoholic fatty liver disease
umr04940  Type I diabetes mellitus
umr05010  Alzheimer disease
umr05022  Pathways of neurodegeneration - multiple diseases
umr05142  Chagas disease
umr05143  African trypanosomiasis
umr05160  Hepatitis C
umr05161  Hepatitis B
umr05162  Measles
umr05163  Human cytomegalovirus infection
umr05164  Influenza A
umr05165  Human papillomavirus infection
umr05167  Kaposi sarcoma-associated herpesvirus infection
umr05168  Herpes simplex virus 1 infection
umr05169  Epstein-Barr virus infection
umr05170  Human immunodeficiency virus 1 infection
umr05200  Pathways in cancer
umr05205  Proteoglycans in cancer
umr05320  Autoimmune thyroid disease
umr05330  Allograft rejection
umr05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103661934 (FAS)
   04668 TNF signaling pathway
    103661934 (FAS)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103661934 (FAS)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103661934 (FAS)
   04217 Necroptosis
    103661934 (FAS)
   04115 p53 signaling pathway
    103661934 (FAS)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    103661934 (FAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103661934 (FAS)
   05205 Proteoglycans in cancer
    103661934 (FAS)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    103661934 (FAS)
   05330 Allograft rejection
    103661934 (FAS)
   05332 Graft-versus-host disease
    103661934 (FAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103661934 (FAS)
   05022 Pathways of neurodegeneration - multiple diseases
    103661934 (FAS)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    103661934 (FAS)
   04932 Non-alcoholic fatty liver disease
    103661934 (FAS)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103661934 (FAS)
   05161 Hepatitis B
    103661934 (FAS)
   05160 Hepatitis C
    103661934 (FAS)
   05164 Influenza A
    103661934 (FAS)
   05162 Measles
    103661934 (FAS)
   05168 Herpes simplex virus 1 infection
    103661934 (FAS)
   05163 Human cytomegalovirus infection
    103661934 (FAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103661934 (FAS)
   05169 Epstein-Barr virus infection
    103661934 (FAS)
   05165 Human papillomavirus infection
    103661934 (FAS)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    103661934 (FAS)
   05143 African trypanosomiasis
    103661934 (FAS)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    103661934 (FAS)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:umr04050]
    103661934 (FAS)
   04090 CD molecules [BR:umr04090]
    103661934 (FAS)
Cytokine receptors [BR:umr04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   103661934 (FAS)
CD molecules [BR:umr04090]
 Proteins
  103661934 (FAS)
SSDB
Motif
Pfam: Death TNFR_c6 CcmH SIT ABC2_membrane_3
Other DBs
NCBI-GeneID: 103661934
NCBI-ProteinID: XP_008687828
UniProt: A0A384BZ12
LinkDB
Position
Un
AA seq 319 aa
MGPNYLALSSSAVVQILTSIARPWPKGVDAQATAVSSKLLRVGKNITIRETGCPEGLHRG
NTFCCQPCPPGTRKEGDCKSERGESICVLCQEGVEYTEEKHFSDKCRRCILCDGEHGLEV
EKNCTRTQNTKCRCKPNFFCNVSECGHCTPCTTCEHGILESCTPTSNTKCKEGSSSKFLW
FCVLIPILVAALICWWMLRRRRKKSNEVLRSTGSTTEMMPINFADIDLSKYITSVSEQMT
ITQVREFVRKNGINEAKIDEIKNDNLQDTAEQKVQLLRNWYQLHGRKDAYCNLIRGLRKA
NFCALAERIEEMIQRDITS
NT seq 960 nt   +upstreamnt  +downstreamnt
atgggtcctaactacttagctttgtcctcctctgcagtggtacagatacttacctccatc
gccagaccatggcctaaaggtgtcgacgctcaagcaacggccgtcagctccaagctgttg
agagtggggaagaacattaccataagggagacggggtgcccggaaggtctgcatcgtggg
aacacgttctgctgtcagccatgtcctcctggcacgcggaaagagggcgactgcaagtct
gagaggggtgaatcaatatgtgtgctctgccaggaaggggtggagtacacagaggagaag
catttttctgataaatgcagaagatgcatactttgtgatggagagcacggcttggaagtg
gaaaaaaactgtacccggacccagaataccaagtgcaggtgtaaaccaaactttttttgt
aacgtctctgaatgcggacactgtaccccgtgcaccacgtgtgaacacggaatccttgag
agctgcacaccaaccagcaacaccaaatgcaaagaaggatccagctccaaatttctgtgg
ttttgtgtcctaatcccgattctagtagctgcactaatatgttggtggatgttaagacgg
cgcaggaagaaaagcaatgaagtccttcgatccacaggctcaaccactgaaatgatgcca
ataaattttgcagacatcgacctgagtaaatatatcactagtgtttctgaacaaatgaca
ataactcaagtcagagaatttgttcggaagaatggtatcaacgaagccaagatagatgag
atcaagaatgacaatctccaagacacagcggaacagaaagtccagttgctccgtaattgg
taccaactccacgggaggaaagatgcatattgcaatttaattagaggcctcagaaaagcc
aatttctgtgcactagcagagagaattgaagaaatgatccagagagacattactagctaa

DBGET integrated database retrieval system