Ursus maritimus (polar bear): 103661934 Help Entry 103661934         CDS       T03271                                  Gene name FAS Definition (RefSeq) Fas cell surface death receptor   KO K04390   tumor necrosis factor receptor superfamily member 6 Organism umr  Ursus maritimus (polar bear) Pathway umr01524   Platinum drug resistance umr04010   MAPK signaling pathway umr04060   Cytokine-cytokine receptor interaction umr04115   p53 signaling pathway umr04210   Apoptosis umr04217   Necroptosis umr04650   Natural killer cell mediated cytotoxicity umr04668   TNF signaling pathway umr04932   Non-alcoholic fatty liver disease umr04940   Type I diabetes mellitus umr05010   Alzheimer disease umr05022   Pathways of neurodegeneration - multiple diseases umr05142   Chagas disease umr05143   African trypanosomiasis umr05160   Hepatitis C umr05161   Hepatitis B umr05162   Measles umr05163   Human cytomegalovirus infection umr05164   Influenza A umr05165   Human papillomavirus infection umr05167   Kaposi sarcoma-associated herpesvirus infection umr05168   Herpes simplex virus 1 infection umr05169   Epstein-Barr virus infection umr05170   Human immunodeficiency virus 1 infection umr05200   Pathways in cancer umr05205   Proteoglycans in cancer umr05320   Autoimmune thyroid disease umr05330   Allograft rejection umr05332   Graft-versus-host disease Brite KEGG Orthology (KO) [BR:umr00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103661934 (FAS)    04668 TNF signaling pathway     103661934 (FAS)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     103661934 (FAS)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     103661934 (FAS)    04217 Necroptosis     103661934 (FAS)    04115 p53 signaling pathway     103661934 (FAS)  09150 Organismal Systems   09151 Immune system    04650 Natural killer cell mediated cytotoxicity     103661934 (FAS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103661934 (FAS)    05205 Proteoglycans in cancer     103661934 (FAS)   09163 Immune disease    05320 Autoimmune thyroid disease     103661934 (FAS)    05330 Allograft rejection     103661934 (FAS)    05332 Graft-versus-host disease     103661934 (FAS)   09164 Neurodegenerative disease    05010 Alzheimer disease     103661934 (FAS)    05022 Pathways of neurodegeneration - multiple diseases     103661934 (FAS)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     103661934 (FAS)    04932 Non-alcoholic fatty liver disease     103661934 (FAS)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     103661934 (FAS)    05161 Hepatitis B     103661934 (FAS)    05160 Hepatitis C     103661934 (FAS)    05164 Influenza A     103661934 (FAS)    05162 Measles     103661934 (FAS)    05168 Herpes simplex virus 1 infection     103661934 (FAS)    05163 Human cytomegalovirus infection     103661934 (FAS)    05167 Kaposi sarcoma-associated herpesvirus infection     103661934 (FAS)    05169 Epstein-Barr virus infection     103661934 (FAS)    05165 Human papillomavirus infection     103661934 (FAS)   09174 Infectious disease: parasitic    05142 Chagas disease     103661934 (FAS)    05143 African trypanosomiasis     103661934 (FAS)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     103661934 (FAS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04050 Cytokine receptors [BR:umr04050]     103661934 (FAS)    04090 CD molecules [BR:umr04090]     103661934 (FAS) Cytokine receptors [BR:umr04050]  Tumor necrosis factor receptors   TNF receptor superfamily    103661934 (FAS) CD molecules [BR:umr04090]  Proteins   103661934 (FAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Death TNFR_c6 CcmH SIT ABC2_membrane_3 Motif Other DBs NCBI-GeneID:  103661934 NCBI-ProteinID:  XP_008687828 UniProt:  A0A384BZ12 LinkDB All DBs Position Un AA seq 319 aa AA seqDB search MGPNYLALSSSAVVQILTSIARPWPKGVDAQATAVSSKLLRVGKNITIRETGCPEGLHRG NTFCCQPCPPGTRKEGDCKSERGESICVLCQEGVEYTEEKHFSDKCRRCILCDGEHGLEV EKNCTRTQNTKCRCKPNFFCNVSECGHCTPCTTCEHGILESCTPTSNTKCKEGSSSKFLW FCVLIPILVAALICWWMLRRRRKKSNEVLRSTGSTTEMMPINFADIDLSKYITSVSEQMT ITQVREFVRKNGINEAKIDEIKNDNLQDTAEQKVQLLRNWYQLHGRKDAYCNLIRGLRKA NFCALAERIEEMIQRDITS NT seq 960 nt NT seq  +upstreamnt  +downstreamnt atgggtcctaactacttagctttgtcctcctctgcagtggtacagatacttacctccatc gccagaccatggcctaaaggtgtcgacgctcaagcaacggccgtcagctccaagctgttg agagtggggaagaacattaccataagggagacggggtgcccggaaggtctgcatcgtggg aacacgttctgctgtcagccatgtcctcctggcacgcggaaagagggcgactgcaagtct gagaggggtgaatcaatatgtgtgctctgccaggaaggggtggagtacacagaggagaag catttttctgataaatgcagaagatgcatactttgtgatggagagcacggcttggaagtg gaaaaaaactgtacccggacccagaataccaagtgcaggtgtaaaccaaactttttttgt aacgtctctgaatgcggacactgtaccccgtgcaccacgtgtgaacacggaatccttgag agctgcacaccaaccagcaacaccaaatgcaaagaaggatccagctccaaatttctgtgg ttttgtgtcctaatcccgattctagtagctgcactaatatgttggtggatgttaagacgg cgcaggaagaaaagcaatgaagtccttcgatccacaggctcaaccactgaaatgatgcca ataaattttgcagacatcgacctgagtaaatatatcactagtgtttctgaacaaatgaca ataactcaagtcagagaatttgttcggaagaatggtatcaacgaagccaagatagatgag atcaagaatgacaatctccaagacacagcggaacagaaagtccagttgctccgtaattgg taccaactccacgggaggaaagatgcatattgcaatttaattagaggcctcagaaaagcc aatttctgtgcactagcagagagaattgaagaaatgatccagagagacattactagctaa

DBGET integrated database retrieval system