KEGG   Ursus maritimus (polar bear): 103663939
Entry
103663939         CDS       T03271                                 

Gene name
SMAD2
Definition
(RefSeq) SMAD family member 2
  KO
K04500  mothers against decapentaplegic homolog 2
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04110  Cell cycle
umr04144  Endocytosis
umr04218  Cellular senescence
umr04350  TGF-beta signaling pathway
umr04371  Apelin signaling pathway
umr04390  Hippo signaling pathway
umr04550  Signaling pathways regulating pluripotency of stem cells
umr04659  Th17 cell differentiation
umr04926  Relaxin signaling pathway
umr04933  AGE-RAGE signaling pathway in diabetic complications
umr05142  Chagas disease
umr05166  Human T-cell leukemia virus 1 infection
umr05200  Pathways in cancer
umr05205  Proteoglycans in cancer
umr05210  Colorectal cancer
umr05212  Pancreatic cancer
umr05225  Hepatocellular carcinoma
umr05226  Gastric cancer
umr05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    103663939 (SMAD2)
   04390 Hippo signaling pathway
    103663939 (SMAD2)
   04371 Apelin signaling pathway
    103663939 (SMAD2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103663939 (SMAD2)
  09143 Cell growth and death
   04110 Cell cycle
    103663939 (SMAD2)
   04218 Cellular senescence
    103663939 (SMAD2)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103663939 (SMAD2)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    103663939 (SMAD2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    103663939 (SMAD2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103663939 (SMAD2)
   05205 Proteoglycans in cancer
    103663939 (SMAD2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103663939 (SMAD2)
   05212 Pancreatic cancer
    103663939 (SMAD2)
   05225 Hepatocellular carcinoma
    103663939 (SMAD2)
   05226 Gastric cancer
    103663939 (SMAD2)
  09163 Immune disease
   05321 Inflammatory bowel disease
    103663939 (SMAD2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103663939 (SMAD2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103663939 (SMAD2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    103663939 (SMAD2)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 103663939
NCBI-ProteinID: XP_008689944
UniProt: A0A384C668
LinkDB
Position
Un
AA seq 449 aa
MSSILPFTPPVVKRLLGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGRLDE
LEKAITTQNCNTKCVTIPSTCSEIWGLSTPNTIDQWDTTGLYSFSEQTRSLDGRLQVSHR
KGLPHVIYCRLWRWPDLHSHHELKAIENCEYAFNLKKDEVCVNPYHYQRVETPVLPPVLV
PRHTEILTELPPLDDYTHSIPENTNFPAGSEPQSNYIPETPPPGYISEDGETSDQQMNQS
MDTDLQPVTYSEPAFWCSIAYYELNQRVGETFHASQPSLTVDGFTDPSNSERFCLGLLSN
VNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPP
GCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWI
ELHLNGPLQWLDKVLTQMGSPSVRCSSMS
NT seq 1350 nt   +upstreamnt  +downstreamnt
atgtcgtccatcttgccattcactccaccggttgtgaaaaggctgctgggttggaagaaa
tcagccggtgggtctggaggagcaggcggaggagagcagaatggacaagaagaaaagtgg
tgtgagaaagcagttaaaagtttggtgaagaagctaaagaaaacaggacgattagatgag
cttgagaaagccatcaccactcaaaattgtaatactaagtgtgtcaccataccaagcact
tgctctgaaatttggggactgagtacaccaaatacgatagatcagtgggatacaacaggc
ctttacagcttctctgaacaaaccaggtctctggatggccgtctacaagtgtctcatcgg
aaaggactgccacacgtgatatattgccgattgtggcgctggcctgaccttcacagtcac
catgagctcaaagcaatcgaaaactgcgaatatgcttttaaccttaaaaaggatgaagta
tgtgtaaacccttaccactaccagagagttgaaacaccagttctgcctccggtactggtg
ccacggcatactgagatcctgacagaactgcctcctctggatgattatacccactccatt
ccagaaaacactaatttcccagcaggaagcgagccacagagtaattacatcccagaaacg
ccgcctcctggatatatcagtgaggatggagaaacaagtgatcaacagatgaaccaaagt
atggatacagatttgcagccagttacttactcagaacctgcattttggtgttcaatagca
tactatgaattaaaccagagggttggcgagaccttccacgcatcacagccctccctcact
gtagacggtttcacagacccatccaattcagagaggttctgcctagggttgctctccaac
gtcaaccgaaatgcgactgtagaaatgacaagaagacatataggaagaggcgtgcgctta
tattacataggtggggaagtttttgctgagtgcctaagtgatagtgcaatctttgtgcag
agccccaactgtaatcagagatacggctggcaccctgcaacagtgtgtaaaattccacca
ggctgtaacctgaagatcttcaacaaccaggaatttgctgctcttctggctcagtctgtt
aatcagggtttcgaagccgtgtatcagctaactagaatgtgcaccataagaatgagtttt
gtgaaggggtggggagcagaataccgaaggcagacggtaacgagcactccttgctggatt
gagcttcatctgaatggacctctacagtggttggacaaagtattgactcagatgggatcc
ccttcagtgcgttgctcgagcatgtcataa

DBGET integrated database retrieval system