KEGG   Ursus maritimus (polar bear): 103664359
Entry
103664359         CDS       T03271                                 

Gene name
KL
Definition
(RefSeq) klotho
  KO
K14756  klotho [EC:3.2.1.31]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr00040  Pentose and glucuronate interconversions
umr00053  Ascorbate and aldarate metabolism
umr01100  Metabolic pathways
umr04211  Longevity regulating pathway
umr04928  Parathyroid hormone synthesis, secretion and action
umr04961  Endocrine and other factor-regulated calcium reabsorption
Module
umr_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:umr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    103664359 (KL)
   00053 Ascorbate and aldarate metabolism
    103664359 (KL)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    103664359 (KL)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    103664359 (KL)
  09149 Aging
   04211 Longevity regulating pathway
    103664359 (KL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:umr02000]
    103664359 (KL)
   04147 Exosome [BR:umr04147]
    103664359 (KL)
Enzymes [BR:umr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.31  beta-glucuronidase
     103664359 (KL)
Transporters [BR:umr02000]
 Other transporters
  Accessory factors involved in transport [TC:8]
   103664359 (KL)
Exosome [BR:umr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103664359 (KL)
SSDB
Motif
Pfam: Glyco_hydro_1
Other DBs
NCBI-GeneID: 103664359
NCBI-ProteinID: XP_008690444
UniProt: A0A384C7J8
LinkDB
Position
Un
AA seq 753 aa
MLPFQFDPLRDLWTAHAKIWHLYNTSFRPTQGGQISIALSSHWISPRRMTDHSIKECQKS
LDFVLGWFAKPIFIDGDYPESMKNNLSSLLPDFTESEKKFIKGTADFFALSFGPTLSFQL
LDPHMKFRQLESPSLRQLLSWIDLEYNHPQIFIVENGWFVSGTTKRDDAKYMYYLKKFIM
ETLKAIRLDGVDVIGYTAWSLMDGFEWHRGYSIRRGLFYVDFLSQDKKLLPKSSALFYQK
LIEKNGFPPLPENQPLEGTFPCDFAWGIVDNYIQVDTTLSQFTDPNVYLWDVHHSKRLIK
VDGAVTKKRKSYCVDFAAIRPQIALLQEMHVSHFHFSLDWALILPLGNLSQVNHTVLHYY
RCVVSELVRANITPVVALWRPAARHHGLPWPLAKHGAWENPRTALAFAEYARLCFQDLGH
HVKFWITMGEPYTRNMTYSAGHNLLKAHALAWRVYDEKFRRSQKGKISIALQADWIEPAC
PFSPKDKEVAERVLEFDIGWLAEPIFGSGDYPRVMRDWLNQRNNFLLPYFTEEEKKLIRG
SFDFLALSHYTTILVDWEKEDPMKYNDYLEVQEMTDITWLNSPGQVAVVPWGLRKVLNWL
KLKYGDLPMYIISNGIDDDPLAAQDRLRVYYMQNYVNEALKAYILDGINLCGYFAYSFND
RTAPKFGLYHYAANQFEPKPSMKHYRKIIDNNGFPGPETLGRFCPEEFTLCTECSLFHTR
KSLLAFIAFLLFAFVVSLSLIFYYSKKGRRSYK
NT seq 2262 nt   +upstreamnt  +downstreamnt
atgttgccatttcagtttgatcccctgcgggacctctggactgctcatgccaaaatctgg
catctctacaatacttctttccgtccaactcagggaggccagatatccattgccctaagc
tcccactggatcagtcctcgaagaatgaccgaccatagcatcaaagaatgtcaaaaatct
cttgactttgtactaggctggtttgccaaacccatatttattgacggtgactatcctgag
agcatgaagaataacctttcatctcttctgcccgattttactgaatctgagaaaaagttc
atcaagggaacagctgacttttttgctctttctttcggaccaaccttgagttttcaacta
ttggaccctcacatgaagttccgccaattagaatctcccagcctgaggcaactcctttct
tggattgaccttgaatataaccaccctcaaatatttattgtggaaaatggctggtttgtc
tcagggaccaccaagagagatgatgccaaatatatgtattacctcaaaaaattcataatg
gaaaccttaaaagccatcaggctggatggggtggacgtcatcgggtacacggcgtggtcc
cttatggatggcttcgagtggcacagaggctacagcatcagacgtgggctcttctatgtc
gactttctcagccaggataagaaactgttgccaaaatcgtcagccttgttctaccaaaag
ctgatagagaaaaatggcttccctcctttacctgagaatcaacccctagaagggacattt
ccctgtgactttgcttggggaattgttgacaactacattcaagtggacaccactctgtct
cagtttaccgacccgaacgtttacctgtgggatgtccaccacagtaagaggctcattaag
gtggacggggcggtgaccaagaagaggaagtcctattgcgtggacttcgcggccatccgg
ccccagatagccttactccaggagatgcacgtttcgcactttcacttctcgctggactgg
gccttgatcctgcctctgggcaacctgtcccaggtgaaccacacggtcctgcactactac
cgctgcgtggtcagcgagctggtgcgcgccaacatcacgccggtggtggcgctctggcgc
cccgccgcccggcaccacggcctgccgtggcccctggccaagcacggcgcctgggagaac
ccccgcaccgccctggcctttgccgagtacgcccggctgtgctttcaggatctcgggcac
cacgtcaagttctggatcacgatgggcgagccgtacactcggaacatgacctacagcgcc
gggcacaatctgctgaaagcgcacgcgttggcctggcgcgtgtacgatgagaagttcagg
cgctctcagaaaggtaaaatatccatagccctgcaggccgattggatagagcccgcctgc
cctttctccccaaaggacaaagaagtggccgagagagttttggaatttgacattggctgg
ctggcggagcccattttcggctccggggattatccacgtgtgatgagggactggctcaac
caaagaaacaacttccttctaccctatttcacggaggaagaaaaaaagctgatccggggt
tcctttgactttctggctttaagccattacaccaccatccttgtcgactgggaaaaagaa
gatccaatgaaatacaacgattacctggaagtgcaggaaatgaccgacatcacctggctc
aactctcccggtcaggtggcagtggtgccctggggcttgcgcaaagttctcaactggctg
aagttgaagtacggagacctccccatgtatataatatccaacggcatagacgatgatccg
ctcgcagcccaagacaggttgagggtgtactacatgcaaaattatgtcaatgaagctctg
aaagcctacatactggacggtatcaatctttgtggatactttgcttattcatttaatgat
cgcacagctccgaagtttggcctctatcattatgctgcaaatcagtttgagcccaaaccg
tccatgaaacattacaggaaaattattgacaacaatggcttcccgggtcccgagactctg
ggtagattttgtccagaggaattcaccctgtgcaccgaatgcagcctttttcatacccga
aagtctttactggctttcattgctttcctactttttgcttttgttgtttctctttccctg
attttctactactctaagaaaggcagaagaagttataaatag

DBGET integrated database retrieval system