KEGG   Ursus maritimus (polar bear): 103665235
Entry
103665235         CDS       T03271                                 

Gene name
DCC
Definition
(RefSeq) DCC netrin 1 receptor
  KO
K06765  deleted in colorectal carcinoma
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04360  Axon guidance
umr05200  Pathways in cancer
umr05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    103665235 (DCC)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103665235 (DCC)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103665235 (DCC)
SSDB
Motif
Pfam: Neogenin_C fn3 I-set Ig_3 Ig_2 ig V-set Pur_ac_phosph_N C2-set_2 Interfer-bind Ig_4 Ig_6 EphA2_TM V-set_CD47 FAM176
Other DBs
NCBI-GeneID: 103665235
NCBI-ProteinID: XP_008691350
UniProt: A0A384CAB3
LinkDB
Position
Un
AA seq 1440 aa
MEIKTLQGFVILGSNIIDLLLQVAGFQIKPFTSLRFLSEPSDAVTMRGGNILLNCSAESD
RGVPVIKWKKDGVHLALGMDERKQQLPNGSLLIQNILHSRHHKPDEGLYQCEASLGDSGS
IISRTAKVAVAGPLRFLSQTESVTAFMGDTVLLKCEVIGEPMPTIHWQKNQQDLTPIPGD
SRVVVLPSGALQISRLQPGDIGIYRCLARNPASSRTGNEAEVRILSDPGLHRQLYFLQRP
SNVVAIEGKDAILECCVSGYPPPSFTWLRGEEGIQPRSKKYSLLGGSNLLISNVTDDDSG
TYTCVVTYKNENISASAELSVLVPPWFLNHPSNLYAYESMDIEFECSVSGKPVPTVNWMK
NGDVVIPSDYFQIVGGSNLRILGVVKSDEGFYQCVAENEAGNAQTSAQLIVPKPAIPSSS
VLPSAPRDVVPVLVSSRFVRLSWRPPAEAKGNIQTFTVFFSREGDNRERALNTSQPGSLQ
LTVGNLKPEAMYTFRVVAYNEWGPGESSQPIKVATQPELQVPGPIENLQAVSTSPTSILI
TWEPPAYANGPVQGYRLFCTEVSTGKEQNIEVDGLSYKLEGLKKFTEYTLRFLAYNRYGP
GVSTDDITVVTLSDVPSAPPQNVSLEVVNSRSIKVSWLPPPSGTQNGFITGYKIRHRKTT
RRGEMETLEPNNLWYLFTGLEKGSQYSFQVSAMTVNGTGPPSNWYTAETPENDLDESQVP
DQPSSLHVRPQTNCIIMSWTPPLNPNIVVRGYIIGYGVGSPYAETVRVDSKQRYYSIERL
ESSSHYVISLKAFNNAGEGVPLYESATTRSITDPTDPVDYYPLLDDFPTSVPDVSTPMLP
PVGVQAVALTHDAVRVSWADNSVPKNQKTSEVRLYTVRWRTSFSANAKYKSEDTTSLSYT
ATGLKPNTMYEFSVMVTKNRRSSTWSMTAHATTYEAAPTSAPKDLTVITREGKPRAVTVS
WQPPLEANGKITAYILFYTLDKNIPIDDWVMETISGDRLTHQIMDLNLDTMYYFRIQARN
AKGVGPLSDPILFRTLKVEHPDKMANDQGRHGDGGYWPVDTNLIDRSTLNEPPIGQMHPP
HGSVTPQKNSNLLVVLVTTVGVITVLVAVIVAVICTRRSSAQQRKKRATHSVSKRKGSQK
DLRPPDLWIHHEEMEMKNIEKPSGTDPTGRDSPIQSCQDLTPVSHSQSETQLGSKSTSHS
GQDTEEAGSSMSTLERSLAARRATRAKLMIPMDAQSNNPAVVSAIPVPTLESAQYPGILP
SPTCGYPHPQFTLRPVPFPTLSVDRGFGAGKTVVSEGPAPQQPPMLPPAQPEHPSNEEAP
SRTIPTACVRPTHPLRSFANPLLPPPMSAIEPKVPYTPLLSQPGPTLPKTHVKTASLGLA
GKARSPLLPVSVPTAPEVSEESHKATEDPANVYEQDDLSEQMASLEGLMKQLNAITGSAF
NT seq 4323 nt   +upstreamnt  +downstreamnt
atggaaattaagacacttcagggatttgtgattttaggtagtaacattattgacttgctt
ctgcaagtggcaggtttccagattaagcctttcacatcactgcgcttcctgtcagagcct
tctgatgccgtcaccatgcggggaggaaatatcctcctgaactgttctgcggagtctgac
cgaggagtcccggttatcaagtggaagaaagatggcgtccacctggccttgggaatggat
gaaaggaagcagcaacttccaaatggctctctgttgatacaaaacatacttcactccagg
caccataagccagatgagggactttaccaatgcgaggcatctttaggagattctgggtca
attattagtcggacagcgaaagttgcagtagcaggaccactaaggttcctatcccagaca
gaatctgtcacagcttttatgggagacacagtgctactcaagtgtgaagtcattggggag
cctatgccaacaatacattggcaaaaaaaccaacaagacctgactcctatcccaggagat
tcccgagtggtggtcttgccctctggcgccttgcagatcagcagacttcaaccgggggac
attggaatctatcgatgcttagctcggaatcccgccagctcaagaacaggaaatgaagca
gaagtcagaattctgtcagacccaggactgcatagacagctatattttctgcaaagacca
tccaatgtggtagccattgaaggaaaagacgccatcctggagtgttgtgtttctggctat
cctcccccgagttttacctggttacgaggagaggaaggcatccaacccaggtccaaaaag
tattccttattgggtggaagcaacttgcttatctccaatgtgacagatgatgatagtgga
acttacacctgtgttgttacatataaaaatgagaatattagtgcctctgcagagctctca
gtcttggttccgccatggtttttaaatcacccttccaacctgtatgcctatgaaagcatg
gatattgagtttgaatgttcagtttctggaaagcctgtgcccactgtgaattggatgaag
aatggagatgtggtcattcctagtgattattttcagatagtgggtggaagcaacctacga
atcctcggagtggtgaagtcagacgaaggcttttatcaatgtgtagctgaaaatgaggct
ggaaatgcccagaccagtgcacagctcattgtccctaagcccgctatcccaagctccagt
gtcctcccttctgctcccagagatgtggtccccgtgttggtttccagtcggttcgttcgt
ctcagctggcgcccacctgcagaagcaaaagggaacattcaaaccttcacggtcttcttc
tccagagaaggtgacaacagggaacgagcattgaacacatcccagcctgggtcccttcag
cttactgtgggaaacctgaagccagaagccatgtataccttccgagttgtggcctacaat
gagtggggaccaggggagagttctcaacccatcaaagtggccactcagcctgaattgcaa
gttccagggccaatagaaaacctgcaagctgtatctacctcacctacctcaattcttatt
acctgggaaccccctgcctatgcaaacggtccagtccaaggttacagattgttctgcact
gaggtgtccacgggaaaggaacagaatatagaagttgatggactatcttataagctggaa
ggcctgaaaaaattcacggaatatactcttcgattcctagcttataatcgctatgggcca
ggagtatctactgacgacataacagtggttacactttctgatgtgccaagtgccccgcct
cagaacgtctccctggaagtagttaattcaaggagtatcaaagtaagctggctgcctcct
ccatcaggcacacaaaatggatttattaccggctataaaattcgacacagaaagacaacc
cgcaggggtgagatggaaacattggagcccaacaacctctggtacctattcacaggactg
gagaaaggaagtcagtacagttttcaagtgtcggccatgacggttaatggcactggaccg
ccttccaactggtacacagcagagactcccgagaatgatctagatgagtctcaagtccct
gaccaaccgagctctcttcacgtgaggccccagaccaactgcatcatcatgagttggact
ccgcccttgaacccaaacatcgtggtgcgaggttacattattggttatggtgttgggagc
ccttatgccgagacagtgcgtgtggatagtaaacaacggtattattccattgagaggtta
gagtcaagttcccattacgtaatctccctaaaagcttttaacaatgcaggagaaggagtt
ccactttatgaaagtgccaccaccagatctataacagatcccactgacccagttgattat
tatcctttgcttgatgatttccccacctcggtcccagatgtctccacccccatgctccca
ccagtaggtgtacaggctgtggctcttacccacgatgccgtgagggtcagctgggcagac
aactctgtccctaagaaccaaaaaacatctgaagtgcgactttacactgtccggtggagg
accagcttttctgcgaatgcgaaatacaagtcagaagacacaacatctctgagttacaca
gcaacaggcctcaaacccaacacaatgtatgagttctcggtcatggtaacaaaaaacaga
aggtcaagcacatggagcatgactgcccatgccacgacatatgaagcagccccgacctct
gctcccaaggatttgacagtcattactcgagaagggaagcctcgcgctgtcaccgtgagt
tggcagcctcccttggaagccaatgggaaaattactgcttacatcttgttttataccttg
gacaagaacataccaattgacgactgggtgatggaaacaatcagtggtgatcggcttact
caccaaatcatggatctcaaccttgacacaatgtactactttcgaatccaagcaagaaat
gcaaaaggagtggggcctctctctgatccgatcctcttcaggactctgaaagtagaacac
cctgacaaaatggctaatgaccaaggtcgtcatggagatggaggttattggccagttgat
actaatttgattgatagaagcactctcaatgagccacccattggccagatgcacccccca
cacggcagcgtcactcctcagaagaacagcaacctgcttgtggtccttgtgaccaccgtt
ggcgtcatcacagtgctggtggcagtgatcgtggctgtgatttgcacccggcgctcttca
gcccagcagagaaagaaacgggccacccacagtgttagcaagaggaagggcagccagaag
gacctcaggccccctgatctttggatacatcacgaagaaatggagatgaaaaatatcgag
aagccatcgggtactgaccctacaggaagggactctcccatccaaagttgccaagacctc
acaccagttagccacagccagtcagaaacccaactggggagcaaaagcacgtctcattca
ggtcaagacactgaagaagcagggagctccatgtccactctggaaaggtcactggctgca
cgtcgagccactcgggccaagcttatgattcctatggatgcccagtccaacaatcctgct
gtcgtgagtgccatccctgtgccaaccctggaaagtgcccagtacccaggaatcctgcca
tctcccacgtgcggatacccccacccgcagtttaccctccggcctgtgccattccccaca
ctgtctgtggaccgaggtttcggagcaggaaaaacggtggtgagtgaaggaccagccccc
caacagccgcccatgttgcccccagcacagcctgagcatcccagcaatgaggaggcacca
agcagaaccatccccacggcctgtgttcgaccaactcacccactccgcagctttgctaac
cccttgctacctccaccaatgagtgcaatagaaccgaaagtcccttacacaccactcttg
tctcagccagggcctactcttcccaagactcatgttaaaacagcctctcttgggttggct
ggaaaggcaagatctcctttgcttcctgtatctgtgccgacagcccctgaagtatccgag
gagagccacaaagccacagaggatccagccaacgtgtatgaacaggatgatttgagtgaa
caaatggcaagcttggaagggctaatgaagcaacttaatgccatcacaggctcggccttt
taa

DBGET integrated database retrieval system