KEGG   Ursus maritimus (polar bear): 103665307
Entry
103665307         CDS       T03271                                 

Gene name
CXCL8
Definition
(RefSeq) C-X-C motif chemokine ligand 8
  KO
K10030  interleukin 8
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04060  Cytokine-cytokine receptor interaction
umr04061  Viral protein interaction with cytokine and cytokine receptor
umr04062  Chemokine signaling pathway
umr04064  NF-kappa B signaling pathway
umr04072  Phospholipase D signaling pathway
umr04218  Cellular senescence
umr04620  Toll-like receptor signaling pathway
umr04621  NOD-like receptor signaling pathway
umr04622  RIG-I-like receptor signaling pathway
umr04657  IL-17 signaling pathway
umr04932  Non-alcoholic fatty liver disease
umr04933  AGE-RAGE signaling pathway in diabetic complications
umr05132  Salmonella infection
umr05133  Pertussis
umr05134  Legionellosis
umr05135  Yersinia infection
umr05142  Chagas disease
umr05144  Malaria
umr05146  Amoebiasis
umr05161  Hepatitis B
umr05163  Human cytomegalovirus infection
umr05164  Influenza A
umr05167  Kaposi sarcoma-associated herpesvirus infection
umr05171  Coronavirus disease - COVID-19
umr05200  Pathways in cancer
umr05202  Transcriptional misregulation in cancer
umr05219  Bladder cancer
umr05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    103665307 (CXCL8)
   04072 Phospholipase D signaling pathway
    103665307 (CXCL8)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103665307 (CXCL8)
   04061 Viral protein interaction with cytokine and cytokine receptor
    103665307 (CXCL8)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    103665307 (CXCL8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103665307 (CXCL8)
   04621 NOD-like receptor signaling pathway
    103665307 (CXCL8)
   04622 RIG-I-like receptor signaling pathway
    103665307 (CXCL8)
   04657 IL-17 signaling pathway
    103665307 (CXCL8)
   04062 Chemokine signaling pathway
    103665307 (CXCL8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103665307 (CXCL8)
   05202 Transcriptional misregulation in cancer
    103665307 (CXCL8)
  09162 Cancer: specific types
   05219 Bladder cancer
    103665307 (CXCL8)
  09163 Immune disease
   05323 Rheumatoid arthritis
    103665307 (CXCL8)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    103665307 (CXCL8)
   04933 AGE-RAGE signaling pathway in diabetic complications
    103665307 (CXCL8)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103665307 (CXCL8)
   05135 Yersinia infection
    103665307 (CXCL8)
   05133 Pertussis
    103665307 (CXCL8)
   05134 Legionellosis
    103665307 (CXCL8)
  09172 Infectious disease: viral
   05161 Hepatitis B
    103665307 (CXCL8)
   05171 Coronavirus disease - COVID-19
    103665307 (CXCL8)
   05164 Influenza A
    103665307 (CXCL8)
   05163 Human cytomegalovirus infection
    103665307 (CXCL8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103665307 (CXCL8)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103665307 (CXCL8)
   05144 Malaria
    103665307 (CXCL8)
   05142 Chagas disease
    103665307 (CXCL8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:umr04052]
    103665307 (CXCL8)
   00536 Glycosaminoglycan binding proteins [BR:umr00536]
    103665307 (CXCL8)
Cytokines and growth factors [BR:umr04052]
 Cytokines
  Chemokines
   103665307 (CXCL8)
Glycosaminoglycan binding proteins [BR:umr00536]
 Heparan sulfate / Heparin
  Chemokines
   103665307 (CXCL8)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 103665307
NCBI-ProteinID: XP_008691432
UniProt: A0A384C9E3
LinkDB
Position
Un
AA seq 101 aa
MTSKLAVALLAVFLLSSALCEAAVLSRMSSELRCQCIKTHSTPFHPKYIRELRVIESGPY
CENSEIIVKLVNGEEVCLDPKEPWVQKIVQIFLKRAEKQKP
NT seq 306 nt   +upstreamnt  +downstreamnt
atgacttccaagctggctgttgctctcttggcagttttcctgctctcttcagcactgtgt
gaagctgcagttctgtcaagaatgagttcagaacttcgatgccagtgcataaagactcac
tctacgcctttccatcccaaatacatcagagaactgagagtgattgagagtggtccatat
tgtgaaaactcagaaatcattgtaaagcttgtcaatggagaagaggtgtgcctggacccc
aaggaaccatgggtacagaagattgtgcagatatttttgaagagggctgagaaacagaaa
ccatga

DBGET integrated database retrieval system