KEGG   Ursus maritimus (polar bear): 103665409
Entry
103665409         CDS       T03271                                 

Gene name
SOS2
Definition
(RefSeq) SOS Ras/Rho guanine nucleotide exchange factor 2
  KO
K03099  son of sevenless
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01521  EGFR tyrosine kinase inhibitor resistance
umr01522  Endocrine resistance
umr04010  MAPK signaling pathway
umr04012  ErbB signaling pathway
umr04014  Ras signaling pathway
umr04062  Chemokine signaling pathway
umr04068  FoxO signaling pathway
umr04072  Phospholipase D signaling pathway
umr04150  mTOR signaling pathway
umr04151  PI3K-Akt signaling pathway
umr04510  Focal adhesion
umr04540  Gap junction
umr04630  JAK-STAT signaling pathway
umr04650  Natural killer cell mediated cytotoxicity
umr04660  T cell receptor signaling pathway
umr04662  B cell receptor signaling pathway
umr04664  Fc epsilon RI signaling pathway
umr04714  Thermogenesis
umr04722  Neurotrophin signaling pathway
umr04810  Regulation of actin cytoskeleton
umr04910  Insulin signaling pathway
umr04912  GnRH signaling pathway
umr04915  Estrogen signaling pathway
umr04917  Prolactin signaling pathway
umr04926  Relaxin signaling pathway
umr04935  Growth hormone synthesis, secretion and action
umr05034  Alcoholism
umr05160  Hepatitis C
umr05161  Hepatitis B
umr05163  Human cytomegalovirus infection
umr05165  Human papillomavirus infection
umr05200  Pathways in cancer
umr05205  Proteoglycans in cancer
umr05206  MicroRNAs in cancer
umr05210  Colorectal cancer
umr05211  Renal cell carcinoma
umr05213  Endometrial cancer
umr05214  Glioma
umr05215  Prostate cancer
umr05220  Chronic myeloid leukemia
umr05221  Acute myeloid leukemia
umr05223  Non-small cell lung cancer
umr05224  Breast cancer
umr05225  Hepatocellular carcinoma
umr05226  Gastric cancer
umr05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103665409 (SOS2)
   04012 ErbB signaling pathway
    103665409 (SOS2)
   04014 Ras signaling pathway
    103665409 (SOS2)
   04630 JAK-STAT signaling pathway
    103665409 (SOS2)
   04068 FoxO signaling pathway
    103665409 (SOS2)
   04072 Phospholipase D signaling pathway
    103665409 (SOS2)
   04151 PI3K-Akt signaling pathway
    103665409 (SOS2)
   04150 mTOR signaling pathway
    103665409 (SOS2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103665409 (SOS2)
   04540 Gap junction
    103665409 (SOS2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103665409 (SOS2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    103665409 (SOS2)
   04660 T cell receptor signaling pathway
    103665409 (SOS2)
   04662 B cell receptor signaling pathway
    103665409 (SOS2)
   04664 Fc epsilon RI signaling pathway
    103665409 (SOS2)
   04062 Chemokine signaling pathway
    103665409 (SOS2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103665409 (SOS2)
   04912 GnRH signaling pathway
    103665409 (SOS2)
   04915 Estrogen signaling pathway
    103665409 (SOS2)
   04917 Prolactin signaling pathway
    103665409 (SOS2)
   04926 Relaxin signaling pathway
    103665409 (SOS2)
   04935 Growth hormone synthesis, secretion and action
    103665409 (SOS2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    103665409 (SOS2)
  09159 Environmental adaptation
   04714 Thermogenesis
    103665409 (SOS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103665409 (SOS2)
   05206 MicroRNAs in cancer
    103665409 (SOS2)
   05205 Proteoglycans in cancer
    103665409 (SOS2)
   05231 Choline metabolism in cancer
    103665409 (SOS2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103665409 (SOS2)
   05225 Hepatocellular carcinoma
    103665409 (SOS2)
   05226 Gastric cancer
    103665409 (SOS2)
   05214 Glioma
    103665409 (SOS2)
   05221 Acute myeloid leukemia
    103665409 (SOS2)
   05220 Chronic myeloid leukemia
    103665409 (SOS2)
   05211 Renal cell carcinoma
    103665409 (SOS2)
   05215 Prostate cancer
    103665409 (SOS2)
   05213 Endometrial cancer
    103665409 (SOS2)
   05224 Breast cancer
    103665409 (SOS2)
   05223 Non-small cell lung cancer
    103665409 (SOS2)
  09165 Substance dependence
   05034 Alcoholism
    103665409 (SOS2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    103665409 (SOS2)
   05160 Hepatitis C
    103665409 (SOS2)
   05163 Human cytomegalovirus infection
    103665409 (SOS2)
   05165 Human papillomavirus infection
    103665409 (SOS2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103665409 (SOS2)
   01522 Endocrine resistance
    103665409 (SOS2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:umr04990]
    103665409 (SOS2)
Domain-containing proteins not elsewhere classified [BR:umr04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   103665409 (SOS2)
SSDB
Motif
Pfam: RasGEF RasGEF_N RhoGEF PH Histone IQ_SEC7_PH PH_19 PH_13
Other DBs
NCBI-GeneID: 103665409
NCBI-ProteinID: XP_008691572
UniProt: A0A384C9T5
LinkDB
Position
Un
AA seq 1272 aa
MAQPRTVQDVEERVQKTFPHPIDKWAIADAQSAIEKRKRRNPLLLPVDKIHPSLKEVLGY
KVDYHVSLYIVAVLEYISADILKLAGNYVFNIRHYEISQQDIKVSMCADKVLMDMFDQDD
IGLVSLCEDEPRSSGELNYYDLVRTEIAEERQYLRELNMIIKVFREAFLSDRKLFKPSDI
DRIFSNISDIHELTVKLLGLIEDTVEMTDESSPHPLAGSCFEDLAEEQAFDPYETLSQDI
LSPKFNEHFSKLMARPAVALHFQSIADGFKEAVRYVLPRLMLVPVYHCWHYFELLKQLKA
CSEEQEDRECLNQAITALMNLQGSMDRIYKQYSPRRRPGDPVCPFYNRQLRSKHLAIKKM
NEIQKNIDGWEGKDIGQCCNEFIMEGPLTRIGAKHERHIFLFDGLMISCKPNHSQSRLPG
YSSAEYRLKEKFVMRKIQICDKEDTCECKHAFELVSKDENSIIFAAKSAEEKNNWMAALI
SLHYRSTLDRMLDSVLLKEENEQPLRLPSPEVYRFVVKDSEENIVFEDNLQSRSGIPIIK
GGTVVKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLSLLIERFEIPEPEPTEADKLA
VEKGEQPISADLKRFRKEYVQPVQLRILNVFRHWVEHHFYDFERDLELLERLESFISSVR
GKAMKKWVESIAKIIKRKKQAQANGISHNITFESPPPAIEWHISRPGQFETFDLMTLHPI
EIARQLTLLESDLYRKVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIVEA
ENFEERVAILSRIIEILQVFQDLNNFNGVLEIVSAVNSVSVYRLDHTFEALQERKRRILD
EAVELSQDHFKKYLVKLKSINPPCVPFFGIYLTNILKTEEGNNDFLKKKGKDLINFSKRR
KVAEITGEIQQYQNQPYCLRIEPEMRRFFENLNPMGSASEKEFTDYLFNKSLEIEPRNCK
QPPRFPRKSTFSLKSPGIRPNAGRHGSTSGTLRGHPTPLEREPCKMSFSRIAETDIESTV
SAPTSPNTPSTPPVSASSDLSVFLDVDLSSSCGSNSIFAPVLLPHSKSFFSSCGSLHKLS
EEPLIPPPLPPRKKFDDDASNCKGNTKSDDDPPAIPPRQPPPPKVKPRVPAPTGAFDGPL
HSPPPPPPRDPLPDTPPPVPLRPPEHFINCPFNLQPPPLGHLHRDPDWFRDVSTCPNSPN
TPPSTPSPRVPRRCYVLSSSHNNLAHPQAPPVPPRQNSSPHLPKLPPKTYKRELSHPPSY
RLPLLENAETPQ
NT seq 3819 nt   +upstreamnt  +downstreamnt
atggctcaaccaaggactgttcaagatgtggaggaacgtgttcaaaagacctttcctcat
ccaattgataaatgggctattgctgatgcacaatctgccatagaaaaacgaaaacgaaga
aatcctctcttactgcctgtggacaaaatccatccttcattgaaggaagttttagggtac
aaagtggactatcatgtatccctatatattgtggctgtgctagagtatatctcagctgat
attttgaagttggctggtaattatgtttttaatatccgacattatgaaatatctcagcag
gacattaaagtgtcaatgtgtgcagataaggttttgatggacatgtttgatcaggatgac
ataggtttggtttctctctgtgaagacgagcctcgttcttcaggtgaattaaactactat
gaccttgtcagaaccgaaattgcagaagaaaggcagtatctacgggaactaaatatgatc
attaaagtgtttcgagaagcctttctttctgacagaaagctgtttaaaccttctgatatt
gacaggattttcagtaacatttcagatatacatgaattaactgtgaaacttttaggtttg
attgaagacacagttgaaatgactgatgaaagcagtcctcatccgttagcgggcagctgt
tttgaagatttggcagaagagcaagcatttgatccttatgaaacattatcacaggacatt
ctttctccaaaatttaatgaacatttcagtaagttgatggccagacctgcggtggctcta
cactttcagtccattgctgatggttttaaagaggcagttcgttatgtccttccacgcctt
atgctggtgcctgtttatcattgttggcactattttgaattattaaagcaattgaaagca
tgtagtgaagagcaggaagacagagaatgtttgaaccaagctattaccgctcttatgaat
ctccaaggtagtatggaccggatttacaagcagtattcacctagacgccgacctggcgat
cctgtttgccctttttataatcgtcaattaagaagcaagcatctggctattaaaaaaatg
aatgaaattcagaaaaacatagacggatgggaaggcaaagatattggacagtgttgtaat
gaattcattatggaaggcccattgacacgaattggtgctaaacatgaacgacatattttt
ctcttcgatggcttaatgattagctgtaaacccaatcatagtcagtcacgccttccaggt
tatagtagtgcagaatacagattaaaagagaaatttgtcatgaggaaaatacaaatatgt
gataaagaagatacttgtgagtgcaaacatgcttttgagttggtatccaaagatgaaaac
agcataatatttgctgctaagtctgccgaagagaaaaacaattggatggccgcgcttatt
tctcttcactatcgtagtacactagatcgaatgctagattcagtgttattgaaagaagaa
aatgagcaaccactgagattaccaagtcctgaagtgtatcgttttgtggtaaaagactct
gaggaaaacattgtttttgaagacaacctgcaaagtagaagtggaatccccattattaaa
ggaggaactgtagtgaaattaattgaaaggttaacatatcatatgtatgcagatcccaat
tttgttcgtacttttcttactacataccgttcattttgtaaaccacaggaattgctaagc
ttactgattgaacgatttgaaattccagagccagaacctactgaagcagataaattggcc
gtagagaaaggcgaacagccaatcagtgcagaccttaaaaggtttcgcaaggaatatgtc
caaccagtacaacttaggatcttaaatgtgtttcggcactgggttgaacaccatttttat
gactttgaaagggatttggaattgcttgaaagactagaatccttcatttcaagtgtaaga
gggaaagctatgaagaagtgggtagagtcaattgctaagatcatcaagagaaagaaacaa
gctcaggcaaatggaataagccataatattacctttgaaagtccacctccagcaattgaa
tggcatatcagcagaccaggacagtttgaaacatttgatctcatgacccttcatccaata
gaaattgcacgtcagctgacgcttttggaatctgatctctacaggaaagtccaaccttct
gaactagtagggagtgtatggacgaaagaagataaagaaataaattctccaaatttatta
aaaatgattcgccataccacaaacctcaccttatggtttgaaaagtgcattgtggaagca
gaaaattttgaggaacgggtggcaatactaagcagaattatagaaattctgcaagttttt
caagatttgaataacttcaatggtgtattggagatagtcagtgcagtaaattcagtgtcg
gtatacagactagaccatacttttgaggcattgcaggaaagaaaaaggagaattttggat
gaagctgtggagttaagtcaagatcactttaaaaaatacctagtaaaactgaagtcaatc
aatccaccttgtgtgcctttttttggaatatatttaacaaatatcctgaaaactgaagaa
gggaataatgattttttaaaaaagaaaggaaaagatttaatcaatttcagtaagaggagg
aaagtagctgaaattactggagaaattcagcagtatcagaatcaaccttactgtttacgg
atagaaccagaaatgaggaggttctttgaaaaccttaaccccatgggaagtgcttctgaa
aaggagtttacagattatttgttcaacaagtcactagaaattgaaccccgaaactgcaaa
cagccacctcgatttcctaggaaatcaactttctctttaaaatctcctggaatacggcct
aatgcaggccgacatggctctacctcaggcactttacgaggtcatccaacgccattagaa
agagaaccatgtaaaatgagctttagtcggattgctgaaactgatattgaatcaactgtg
tcagcaccaacctctccaaatacaccatctactccaccagtatctgcttcttcagacctt
agtgtgtttttagatgtggacctcagcagttcctgtggcagcaatagcatctttgctcca
gtcctcttgccacattcaaaatctttcttcagttcatgtggtagtttacataaactaagt
gaagagccactgattcctcctccacttcctcctcgaaaaaagtttgacgacgatgcttca
aactgcaagggaaacacgaaatctgatgatgacccccctgctattccaccaagacagcct
cctcctccaaaggtaaaacccagagttcctgctcctactggtgcatttgatgggcctctg
cacagtccacctccaccgccaccaagagatcctcttcctgatacccctccaccagttccc
cttcggcctccagaacactttataaactgtccgtttaatcttcagccacctccactagga
catcttcacagagatccagactggttcagagatgttagtacctgtccaaactcgccaaat
actcctcctagcacaccctctccgagagtaccacgtcgatgctacgtgctcagttccagt
cacaacaaccttgctcatcctcaagctccccctgttccaccaaggcagaattcaagccct
cacctaccaaaactgccaccaaagacttacaaacgggagctttcgcaccctccatcatac
agactgcctttgctagaaaatgcggaaactcctcagtga

KEGG   Ursus maritimus (polar bear): 103671891
Entry
103671891         CDS       T03271                                 

Gene name
SOS1
Definition
(RefSeq) SOS Ras/Rac guanine nucleotide exchange factor 1
  KO
K03099  son of sevenless
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01521  EGFR tyrosine kinase inhibitor resistance
umr01522  Endocrine resistance
umr04010  MAPK signaling pathway
umr04012  ErbB signaling pathway
umr04014  Ras signaling pathway
umr04062  Chemokine signaling pathway
umr04068  FoxO signaling pathway
umr04072  Phospholipase D signaling pathway
umr04150  mTOR signaling pathway
umr04151  PI3K-Akt signaling pathway
umr04510  Focal adhesion
umr04540  Gap junction
umr04630  JAK-STAT signaling pathway
umr04650  Natural killer cell mediated cytotoxicity
umr04660  T cell receptor signaling pathway
umr04662  B cell receptor signaling pathway
umr04664  Fc epsilon RI signaling pathway
umr04714  Thermogenesis
umr04722  Neurotrophin signaling pathway
umr04810  Regulation of actin cytoskeleton
umr04910  Insulin signaling pathway
umr04912  GnRH signaling pathway
umr04915  Estrogen signaling pathway
umr04917  Prolactin signaling pathway
umr04926  Relaxin signaling pathway
umr04935  Growth hormone synthesis, secretion and action
umr05034  Alcoholism
umr05160  Hepatitis C
umr05161  Hepatitis B
umr05163  Human cytomegalovirus infection
umr05165  Human papillomavirus infection
umr05200  Pathways in cancer
umr05205  Proteoglycans in cancer
umr05206  MicroRNAs in cancer
umr05210  Colorectal cancer
umr05211  Renal cell carcinoma
umr05213  Endometrial cancer
umr05214  Glioma
umr05215  Prostate cancer
umr05220  Chronic myeloid leukemia
umr05221  Acute myeloid leukemia
umr05223  Non-small cell lung cancer
umr05224  Breast cancer
umr05225  Hepatocellular carcinoma
umr05226  Gastric cancer
umr05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103671891 (SOS1)
   04012 ErbB signaling pathway
    103671891 (SOS1)
   04014 Ras signaling pathway
    103671891 (SOS1)
   04630 JAK-STAT signaling pathway
    103671891 (SOS1)
   04068 FoxO signaling pathway
    103671891 (SOS1)
   04072 Phospholipase D signaling pathway
    103671891 (SOS1)
   04151 PI3K-Akt signaling pathway
    103671891 (SOS1)
   04150 mTOR signaling pathway
    103671891 (SOS1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103671891 (SOS1)
   04540 Gap junction
    103671891 (SOS1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103671891 (SOS1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    103671891 (SOS1)
   04660 T cell receptor signaling pathway
    103671891 (SOS1)
   04662 B cell receptor signaling pathway
    103671891 (SOS1)
   04664 Fc epsilon RI signaling pathway
    103671891 (SOS1)
   04062 Chemokine signaling pathway
    103671891 (SOS1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103671891 (SOS1)
   04912 GnRH signaling pathway
    103671891 (SOS1)
   04915 Estrogen signaling pathway
    103671891 (SOS1)
   04917 Prolactin signaling pathway
    103671891 (SOS1)
   04926 Relaxin signaling pathway
    103671891 (SOS1)
   04935 Growth hormone synthesis, secretion and action
    103671891 (SOS1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    103671891 (SOS1)
  09159 Environmental adaptation
   04714 Thermogenesis
    103671891 (SOS1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103671891 (SOS1)
   05206 MicroRNAs in cancer
    103671891 (SOS1)
   05205 Proteoglycans in cancer
    103671891 (SOS1)
   05231 Choline metabolism in cancer
    103671891 (SOS1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103671891 (SOS1)
   05225 Hepatocellular carcinoma
    103671891 (SOS1)
   05226 Gastric cancer
    103671891 (SOS1)
   05214 Glioma
    103671891 (SOS1)
   05221 Acute myeloid leukemia
    103671891 (SOS1)
   05220 Chronic myeloid leukemia
    103671891 (SOS1)
   05211 Renal cell carcinoma
    103671891 (SOS1)
   05215 Prostate cancer
    103671891 (SOS1)
   05213 Endometrial cancer
    103671891 (SOS1)
   05224 Breast cancer
    103671891 (SOS1)
   05223 Non-small cell lung cancer
    103671891 (SOS1)
  09165 Substance dependence
   05034 Alcoholism
    103671891 (SOS1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    103671891 (SOS1)
   05160 Hepatitis C
    103671891 (SOS1)
   05163 Human cytomegalovirus infection
    103671891 (SOS1)
   05165 Human papillomavirus infection
    103671891 (SOS1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103671891 (SOS1)
   01522 Endocrine resistance
    103671891 (SOS1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:umr04990]
    103671891 (SOS1)
Domain-containing proteins not elsewhere classified [BR:umr04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   103671891 (SOS1)
SSDB
Motif
Pfam: RasGEF RasGEF_N RhoGEF Histone PH_10
Other DBs
NCBI-GeneID: 103671891
NCBI-ProteinID: XP_008698769
UniProt: A0A384CW95
LinkDB
Position
Un
AA seq 1275 aa
MQVQGQVHPTLESSDDALQYVEELILQLLNMLCQAQPRSASDVEERVQKSFPHPIDKWAI
ADAQSAIEKRKRRNPLSLPVEKIHPLLKEVLGYKIDHQVSVYIVAVLEYISADILKLVGN
YVRNIRHYEITKQDIKVAMCADKVLMDMFHQDVEDINILSLTDEEPSTSGEQTYYDLVKA
FMAEIRQYIRELNLIIKVFREPFVSNSKLFSANDVENIFSRIVDIHELSVKLLGHIEDTV
EMTDEGSPHPLVGSCFEDLAEELAFDPYESYARDILRPGFHDRFLSQLSKPGAALYLQSI
GEGFKEAVQYVLPRLLLAPVYHCLHYFELLKQLEEKSEDQEDKECLKQAITALLNVQSGM
EKICSKSLAKRRLSESACRFYSQQMKGKQLAIKKMNEIQKNIDGWEGKDIGQCCNEFIME
GTLTRVGAKHERHIFLFDGLMICCKSNHGQPRLPGASNAEYRLKEKFFMRKSAEEKNNWM
AALISLQYRSTLERILDVTMLQEEKEEQMRLPSADVYRFAEPDSEENIIFEENMQPKAGI
PIIKAGTVIKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLSLIIERFEIPEPEPTEA
DRIAIENGDQPLSAELKRFRKEYIQPVQLRVLNVCRHWVEHHFYDFERDADLLQRMEEFI
GTVRGKAMKKWVESITKIIQRKKIARDNGPGHNITFQSSPPTVEWHISRPGHIETFDLLT
LHPIEIARQLTLLESDLYRAVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKC
IVETENLEERVAVVSRIIEILQVFQELNNFNGVLEVVSAMNSSPVYRLDHTFEQIPSRQK
KILEEAHELSEDHYKKYLAKLRSINPPCVPFFGIYLTNILKTEEGNPEVLKRHGKELINF
SKRRKVAEITGEIQQYQNQPYCLRVESDIKRFFENLNPMGNSMEKEFTDYLFNKSLEIEP
RNPKPLPRFPKKYSYPLKSPGVRPSNPRPGTMRHPTPLQQEPRKISYSRIPESETESTAS
APNSPRTPLTPPPASGASSTTDVCSVFDSDHSSPFHSSSDTVFIQVSLPHGPRSASVSSI
SLTKGTDEVPVPPPVPPRRRPESAPAESSPSKIMSKHLDSPPAIPPRQPTSKAYSPRYSI
SDRTSLSDPPESPPLLPPREPVRTPDVFSSSPLHLQPPPLGKKSDHGNAFFPNSPSPFTP
PPPQTPSPHGTRRHLPSPPLTQEVDLSSVTGPPVPPRQSTSQHIPKLPPKTYKREHTHPS
MHRDGPPLLENAHSS
NT seq 3828 nt   +upstreamnt  +downstreamnt
atgcaggtccaggggcaagttcatccgactcttgagtctagtgatgatgctcttcagtat
gttgaggaattaattttgcagttattaaatatgctatgccaagctcagccccgaagcgct
tcagatgtagaggaacgtgttcaaaaaagtttccctcatccaattgataagtgggcaata
gctgatgcccaatcggctattgaaaagaggaagcgaagaaaccctttatctctcccagta
gaaaaaattcatcctttactaaaggaggtcctaggttataaaattgaccaccaggtttct
gtttacatagtagcagtattagaatacatttctgcagacatcttaaagctggtggggaat
tatgtacgaaatatacggcattatgaaattacaaaacaagatattaaagtggcaatgtgt
gctgataaggtattaatggacatgtttcatcaagatgtagaagatataaatatattatct
ttaactgatgaagagccttccacctcaggagagcaaacttattatgatttggtaaaagca
tttatggcagaaattcgacagtacataagggaactaaatttaattataaaagtttttaga
gagccctttgtctccaattcaaaattgttttcagctaatgatgtagaaaatatatttagc
cgtatagtagatatacacgaacttagtgtaaagttactgggccatatagaagatactgtg
gaaatgactgatgaaggtagcccccatcccttagtaggaagctgctttgaagacttagca
gaggaactggcatttgatccatatgaatcatatgctcgagatattttacggcctggtttt
catgatcgtttccttagtcagttatcaaagcctggagcggcactctatttacagtcaata
ggcgaaggtttcaaagaagctgttcagtatgttttacccaggctacttctagcccctgtt
taccactgtctacattactttgaacttttgaagcagttagaagaaaagagtgaagatcaa
gaagacaaggaatgtttgaaacaagcaataacagctttgcttaatgttcagagtggtatg
gaaaaaatatgttctaaaagtcttgcaaaacgaagactgagtgaatctgcatgtcggttt
tatagtcagcaaatgaaggggaaacaactagcaatcaagaaaatgaacgagattcaaaag
aatattgatggttgggagggaaaagacattggacagtgttgcaatgaatttataatggaa
ggaactcttacacgtgtaggagccaaacatgaaagacacatatttctctttgatggctta
atgatttgctgtaaatcaaaccatgggcagccaagactccctggtgctagcaacgcagag
tatcgtcttaaagaaaagtttttcatgagaaagtcagctgaagagaaaaacaattggatg
gcagcactgatatctttacagtaccggagtacgctggagaggatactcgatgtgacgatg
ctgcaggaagagaaggaggagcagatgaggctccctagtgccgatgtttatagatttgca
gagcctgactctgaagagaatataatatttgaagaaaacatgcagcccaaggctggaatc
ccaattatcaaagcgggaactgttattaaacttatagagaggctcacataccatatgtat
gcagatcccaattttgttcggacatttcttacaacatacagatccttttgtaaacctcaa
gaactactgagtcttataatagaaaggtttgaaattccagagcctgagccaacagaagct
gatcgcatagccatagagaatggagatcagcccttgagtgcagaactaaaaaggtttaga
aaagaatacatacagcctgtacagctgcgagtattaaatgtatgtcggcattgggtagag
caccacttctatgattttgaaagggatgcagatcttttgcagcgaatggaagaatttatt
ggaacagtgagaggtaaagcaatgaaaaaatgggttgaatccatcactaaaataatccaa
aggaaaaaaattgcaagagacaatggaccaggtcataatattacatttcagagttcacct
cccacagttgagtggcatataagcaggcctgggcacatagagacttttgacctgctcacc
ttacacccaatagaaattgctcgacaactcactttacttgaatcagatctatatcgagct
gtacagccatcagaattagttggaagtgtgtggacaaaagaagacaaagaaattaattct
cctaatcttctaaaaatgatccggcataccactaacctcactctgtggtttgagaaatgt
attgtagaaactgaaaacttagaagaaagagtagctgtggtgagtcgaataattgagatt
ctacaagtctttcaagagctgaacaacttcaacggtgtccttgaggttgtcagtgctatg
aactcctcacctgtttacagactagaccacacatttgagcaaataccaagtcgccaaaag
aaaattttagaagaagctcatgaattaagtgaagatcactataagaaatatttggcaaaa
ctcaggtctattaatccaccgtgcgtgcctttctttggaatttatctaactaatatcttg
aaaacagaagaaggcaaccctgaggtcctaaaaaggcatggaaaagagcttataaacttt
agcaaaaggaggaaagtagcagaaataacaggagagatccagcaataccaaaatcagcct
tattgtttacgagtagaatcagatatcaaaaggttctttgaaaatttgaatccaatggga
aatagcatggaaaaagaatttacagattatcttttcaacaaatccctagaaatagaacca
cgaaaccctaagcctctcccaagatttccaaaaaaatatagctatcccctaaaatctcct
ggtgttcgtccatcaaacccaagaccaggtaccatgagacatcccacacctctgcagcag
gagcccaggaaaatcagttacagtaggatccccgaaagtgaaacagaaagtacagcgtct
gcaccgaattctccaagaacaccgttaacacctccgcctgcttccggcgcttctagtacc
acggatgtttgcagcgtttttgattccgatcattcgagcccttttcactcaagcagcgat
accgtctttatccaagtttcactgccccatggcccaagatctgcttcagtatcatctata
agtctaaccaagggcactgatgaagtgcctgtcccccctcctgtccctccacgaagacgg
ccagaatccgcccccgccgagtcttcgccgtctaagattatgtctaagcatttggacagc
cccccagcaattcctcctaggcagcccacatcaaaagcctattcaccacgatattcaata
tcagaccggacctcgctatcagaccctcctgagagccctcccttattaccaccacgagaa
cctgtgaggacacctgatgttttctccagctcaccactacatctgcagcctccccctttg
ggcaaaaaaagtgatcatggcaatgccttcttcccgaacagcccttccccttttacaccg
cctcctcctcaaacaccctctcctcatggcacgagaaggcatctgccatcgccaccactg
acacaagaagtggacctttcttccgtcactgggccgcctgttcctccacgacaaagcact
tctcaacatatccctaaactccctccaaaaacttacaaaagggagcacacacacccatcc
atgcacagggatggcccaccgctgctggagaacgcccattcgtcctga

DBGET integrated database retrieval system