KEGG   Ursus maritimus (polar bear): 103665536
Entry
103665536         CDS       T03271                                 

Gene name
CDKN1A
Definition
(RefSeq) cyclin dependent kinase inhibitor 1A
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01522  Endocrine resistance
umr01524  Platinum drug resistance
umr04012  ErbB signaling pathway
umr04066  HIF-1 signaling pathway
umr04068  FoxO signaling pathway
umr04110  Cell cycle
umr04115  p53 signaling pathway
umr04151  PI3K-Akt signaling pathway
umr04218  Cellular senescence
umr04630  JAK-STAT signaling pathway
umr04921  Oxytocin signaling pathway
umr04928  Parathyroid hormone synthesis, secretion and action
umr04934  Cushing syndrome
umr05160  Hepatitis C
umr05161  Hepatitis B
umr05163  Human cytomegalovirus infection
umr05165  Human papillomavirus infection
umr05166  Human T-cell leukemia virus 1 infection
umr05167  Kaposi sarcoma-associated herpesvirus infection
umr05169  Epstein-Barr virus infection
umr05200  Pathways in cancer
umr05202  Transcriptional misregulation in cancer
umr05203  Viral carcinogenesis
umr05205  Proteoglycans in cancer
umr05206  MicroRNAs in cancer
umr05210  Colorectal cancer
umr05211  Renal cell carcinoma
umr05212  Pancreatic cancer
umr05213  Endometrial cancer
umr05214  Glioma
umr05215  Prostate cancer
umr05216  Thyroid cancer
umr05217  Basal cell carcinoma
umr05218  Melanoma
umr05219  Bladder cancer
umr05220  Chronic myeloid leukemia
umr05222  Small cell lung cancer
umr05223  Non-small cell lung cancer
umr05224  Breast cancer
umr05225  Hepatocellular carcinoma
umr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103665536 (CDKN1A)
   04630 JAK-STAT signaling pathway
    103665536 (CDKN1A)
   04066 HIF-1 signaling pathway
    103665536 (CDKN1A)
   04068 FoxO signaling pathway
    103665536 (CDKN1A)
   04151 PI3K-Akt signaling pathway
    103665536 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103665536 (CDKN1A)
   04115 p53 signaling pathway
    103665536 (CDKN1A)
   04218 Cellular senescence
    103665536 (CDKN1A)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    103665536 (CDKN1A)
   04928 Parathyroid hormone synthesis, secretion and action
    103665536 (CDKN1A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103665536 (CDKN1A)
   05202 Transcriptional misregulation in cancer
    103665536 (CDKN1A)
   05206 MicroRNAs in cancer
    103665536 (CDKN1A)
   05205 Proteoglycans in cancer
    103665536 (CDKN1A)
   05203 Viral carcinogenesis
    103665536 (CDKN1A)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103665536 (CDKN1A)
   05212 Pancreatic cancer
    103665536 (CDKN1A)
   05225 Hepatocellular carcinoma
    103665536 (CDKN1A)
   05226 Gastric cancer
    103665536 (CDKN1A)
   05214 Glioma
    103665536 (CDKN1A)
   05216 Thyroid cancer
    103665536 (CDKN1A)
   05220 Chronic myeloid leukemia
    103665536 (CDKN1A)
   05217 Basal cell carcinoma
    103665536 (CDKN1A)
   05218 Melanoma
    103665536 (CDKN1A)
   05211 Renal cell carcinoma
    103665536 (CDKN1A)
   05219 Bladder cancer
    103665536 (CDKN1A)
   05215 Prostate cancer
    103665536 (CDKN1A)
   05213 Endometrial cancer
    103665536 (CDKN1A)
   05224 Breast cancer
    103665536 (CDKN1A)
   05222 Small cell lung cancer
    103665536 (CDKN1A)
   05223 Non-small cell lung cancer
    103665536 (CDKN1A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103665536 (CDKN1A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103665536 (CDKN1A)
   05161 Hepatitis B
    103665536 (CDKN1A)
   05160 Hepatitis C
    103665536 (CDKN1A)
   05163 Human cytomegalovirus infection
    103665536 (CDKN1A)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103665536 (CDKN1A)
   05169 Epstein-Barr virus infection
    103665536 (CDKN1A)
   05165 Human papillomavirus infection
    103665536 (CDKN1A)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    103665536 (CDKN1A)
   01522 Endocrine resistance
    103665536 (CDKN1A)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 103665536
NCBI-ProteinID: XP_008691705
UniProt: A0A384CBD3
LinkDB
Position
Un
AA seq 146 aa
MTEPSGDAQQVPRGSKDALMAGCVQEARERWNFDFVTETPLEGDFAWERVWGLGLPKLYL
PAGPWGGRDDLGGGKRPSPSPALLQGTAQEDHLDLSLSCTLMPHAPERPEASPGAPGTSQ
GRRRRQTSMTDFYHSKRRLIFSKRKP
NT seq 441 nt   +upstreamnt  +downstreamnt
atgacggagccgtccggggacgcccagcaggtcccgcgtggcagcaaggacgcgctgatg
gcgggctgcgtgcaggaggccagggagcgatggaacttcgacttcgtcaccgagacaccg
ctggagggcgactttgcctgggagcgcgtgtggggcctgggcctgcccaagctctacctg
cctgcggggccctgggggggccgggatgacctgggagggggcaagcggcccagcccctcg
cctgccctgctgcaggggaccgctcaggaggaccacctggacctgtcgctgtcctgcacc
ctcatgcctcacgcccctgagcggcccgaggcgtccccgggggctcctggcacctctcag
ggccggagacggcggcagaccagcatgacagatttctatcactccaaacgccggctgatc
ttctccaaaaggaagccctga

DBGET integrated database retrieval system