KEGG   Ursus maritimus (polar bear): 103665963
Entry
103665963         CDS       T03271                                 

Gene name
BIRC5
Definition
(RefSeq) baculoviral IAP repeat containing 5
  KO
K08731  baculoviral IAP repeat-containing protein 5
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01524  Platinum drug resistance
umr04210  Apoptosis
umr04215  Apoptosis - multiple species
umr04390  Hippo signaling pathway
umr05161  Hepatitis B
umr05200  Pathways in cancer
umr05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    103665963 (BIRC5)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103665963 (BIRC5)
   04215 Apoptosis - multiple species
    103665963 (BIRC5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103665963 (BIRC5)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103665963 (BIRC5)
  09172 Infectious disease: viral
   05161 Hepatitis B
    103665963 (BIRC5)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    103665963 (BIRC5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:umr01002]
    103665963 (BIRC5)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:umr03036]
    103665963 (BIRC5)
Peptidases and inhibitors [BR:umr01002]
 Peptidase inhibitors
  Family I32: IAP family
   103665963 (BIRC5)
Chromosome and associated proteins [BR:umr03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CPC (chromosomal passenger complex)
     103665963 (BIRC5)
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    103665963 (BIRC5)
SSDB
Motif
Pfam: BIR
Other DBs
NCBI-GeneID: 103665963
NCBI-ProteinID: XP_008692219
UniProt: A0A384CCN5
LinkDB
Position
Un
AA seq 188 aa
MAEAVIATPPAVGSQTLGRPLPLWAPGRPLQRWAGSRVKPLPLWALGPRGDPSLCGILAG
ATPPATGSWDPGAPQLSLSSPLQMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDDPI
EEHKKHSSGCAFLSVKKQFEELTLSEFLKLDKERAKNKIAKETNSKQKEFEETAKRVRGA
IEQLAAVE
NT seq 567 nt   +upstreamnt  +downstreamnt
atggcagaagctgttattgcaacccctccagctgtgggctcccagaccctggggcgaccc
ctccctctgtgggcccccgggcgacccctccagcggtgggccggcagccgcgtgaaaccc
ctccctctgtgggctcttgggccccggggtgacccctctctctgtgggatcctggccggg
gctacccctcccgctacgggctcctgggaccctggagcgcctcagctgagcctcagctct
cccttgcagatggcagaggccggcttcatccactgtcccactgagaacgagcccgacttg
gcccagtgtttcttctgcttcaaggagctggaaggctgggagccagatgatgaccctata
gaggagcataaaaagcattcatctggttgtgctttcctttctgtcaagaagcagtttgaa
gagttaaccctcagtgaatttttgaaactggacaaagaaagagccaagaacaaaatcgca
aaggaaaccaacagtaagcagaaagaatttgaagagaccgcaaagagagtgcgcggtgcc
atcgagcagctggccgccgtggagtaa

DBGET integrated database retrieval system