KEGG   Ursus maritimus (polar bear): 103666919
Entry
103666919         CDS       T03271                                 

Gene name
ELK1
Definition
(RefSeq) ELK1, ETS transcription factor
  KO
K04375  ETS domain-containing protein Elk-1
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04010  MAPK signaling pathway
umr04012  ErbB signaling pathway
umr04014  Ras signaling pathway
umr04510  Focal adhesion
umr04910  Insulin signaling pathway
umr04912  GnRH signaling pathway
umr04921  Oxytocin signaling pathway
umr05140  Leishmaniasis
umr05161  Hepatitis B
umr05163  Human cytomegalovirus infection
umr05166  Human T-cell leukemia virus 1 infection
umr05200  Pathways in cancer
umr05205  Proteoglycans in cancer
umr05213  Endometrial cancer
umr05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103666919 (ELK1)
   04012 ErbB signaling pathway
    103666919 (ELK1)
   04014 Ras signaling pathway
    103666919 (ELK1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103666919 (ELK1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103666919 (ELK1)
   04912 GnRH signaling pathway
    103666919 (ELK1)
   04921 Oxytocin signaling pathway
    103666919 (ELK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103666919 (ELK1)
   05205 Proteoglycans in cancer
    103666919 (ELK1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103666919 (ELK1)
   05213 Endometrial cancer
    103666919 (ELK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103666919 (ELK1)
   05161 Hepatitis B
    103666919 (ELK1)
   05163 Human cytomegalovirus infection
    103666919 (ELK1)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    103666919 (ELK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:umr03000]
    103666919 (ELK1)
Transcription factors [BR:umr03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    103666919 (ELK1)
SSDB
Motif
Pfam: Ets
Other DBs
NCBI-GeneID: 103666919
NCBI-ProteinID: XP_008693260
UniProt: A0A384CFR1
LinkDB
Position
Un
AA seq 295 aa
MDPSVTLWQFLLQLLREQGQGXXXXXXXXXXXLVDAEQVARLWGLRKNKTNMNYDKLSRA
LRYYYDKNIIRKVSGQKFVYKFVSYPEVARCSTEDCPPQPEVSITSTVANVAPSAVHAVP
GGMARSSRNEYMRSGLYSTFTIQSLQPQPQPPPHPRPASVLPNTAPSGAAVPPSGSRSTS
PSPLEACLEAEEAGLPLQVRTGIWKFSKRVGVQFLDEEGCWSPTTPSPQTPVLLTPSSLP
PSIHFWSTLSPIAPRSPAKLSFQFPSSGSAQVHIPSISVDGLSTPVVLSPGPQKP
NT seq 888 nt   +upstreamnt  +downstreamnt
atggacccctctgtgacgctgtggcagtttctgctgcagctgctgagagaacaaggccag
ggnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnngctggtggacgctgagcaggtggcc
cggctgtgggggctgcgtaagaacaagaccaacatgaattacgacaagctcagccgggcc
ctgcggtactactatgacaagaacatcatccgcaaagtgagcggccagaagtttgtctac
aagtttgtgtcctaccccgaagtcgcgaggtgctccactgaggactgcccgccccagcct
gaggtgtctatcacctctactgtggcaaatgtggccccttctgctgtacatgctgtcccc
gggggcatggcacgcagcagccggaacgagtacatgcgctcaggcctctattccaccttc
accatccagtccctgcagccacagccacagccgccccctcatcctcggcctgcctcggtg
ctccccaacaccgccccatcgggagcagcagtgcccccatctgggagcaggagcaccagt
ccaagccccttagaggcctgcctggaggctgaggaggccggcctgcctctgcaggtaagg
actggaatatggaaattcagtaagagggtgggcgtacaattcctagatgaggaggggtgc
tggtctccaactaccccttccccacagaccccggtgctgctgacgcccagctcgctgccc
cccagcattcacttctggagcaccctgagtcccattgcaccccgtagcccagccaagctc
tccttccagtttccgtccagtggcagcgcccaggtgcacatcccttccatcagcgtggat
ggcctctcaacccccgtggtgctctccccagggccccagaagccatga

DBGET integrated database retrieval system