KEGG   Ursus maritimus (polar bear): 103667420
Entry
103667420         CDS       T03271                                 

Gene name
NOS2
Definition
(RefSeq) nitric oxide synthase 2
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr00220  Arginine biosynthesis
umr00330  Arginine and proline metabolism
umr01100  Metabolic pathways
umr04020  Calcium signaling pathway
umr04066  HIF-1 signaling pathway
umr04146  Peroxisome
umr04371  Apelin signaling pathway
umr04926  Relaxin signaling pathway
umr05010  Alzheimer disease
umr05014  Amyotrophic lateral sclerosis
umr05022  Pathways of neurodegeneration - multiple diseases
umr05133  Pertussis
umr05140  Leishmaniasis
umr05142  Chagas disease
umr05145  Toxoplasmosis
umr05146  Amoebiasis
umr05152  Tuberculosis
umr05200  Pathways in cancer
umr05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    103667420 (NOS2)
   00330 Arginine and proline metabolism
    103667420 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    103667420 (NOS2)
   04066 HIF-1 signaling pathway
    103667420 (NOS2)
   04020 Calcium signaling pathway
    103667420 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    103667420 (NOS2)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    103667420 (NOS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103667420 (NOS2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    103667420 (NOS2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103667420 (NOS2)
   05014 Amyotrophic lateral sclerosis
    103667420 (NOS2)
   05022 Pathways of neurodegeneration - multiple diseases
    103667420 (NOS2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    103667420 (NOS2)
   05152 Tuberculosis
    103667420 (NOS2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103667420 (NOS2)
   05145 Toxoplasmosis
    103667420 (NOS2)
   05140 Leishmaniasis
    103667420 (NOS2)
   05142 Chagas disease
    103667420 (NOS2)
Enzymes [BR:umr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     103667420 (NOS2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1
Other DBs
NCBI-GeneID: 103667420
NCBI-ProteinID: XP_008693791
UniProt: A0A384CG13
LinkDB
Position
Un
AA seq 1078 aa
MLAVSFYSLVTQDDPKCHSLGKHRNESPQSLTGTVKTSPESLIKLDSPPSACPRHVRIKN
WGSGMTFQDTLHHKAKGDIACKSKSCLGAIMNPKSLTRGPRDKPTPPDELLPQAIEFVNQ
YYGSFKEAKIEEHLARVEAVTKEIETTGTYQLTGDELIFATKQAWRNAPRCIGRIQWSNL
QVFDARSCSTAKEMFEHICRHLRYATNNGNIRSAITVFPQRSDGKHDFRVWNAQLIRYAG
YQMPDGTILGDPASVEFTQLCIDLGWKPKYSRFDVVPLVLQADGQDPEFFEIPPDLVLEV
PMEHPKYEWFRELQLKWYALPAVANMLLEVGGLEFPGCPFNGWYMGTEIGVRDFCDVQRY
NILEEVGRRMGLETHKLASLWKDRAVVEINVAVLHSFQKRNVSIMDHHSAAESFMKYMQN
EYRSRGGCPADWIWLVPPISGSITPVFHQEMLNYVLSPFYYYQVEAWKTHTWQDEKRRPR
RRKIPFKVLVKAVLFSAMLMCKTMASRVRATILFATETGKSETLARDLGALFSCAFNPKV
LCMDEYRLRHLEDEQLLLVVTSTFGNGDSPGNGEKLKKSLFLLKELTNKFRYAVFGLGSS
MYPQFCAFAHDIDQKLSHLGASQLAPTGEGDELSGQEEAFRSWAVQTFKAACETFEVRGK
HRIQIPRLYTCNVTWDPQHYRLVQDSQPLDLERALSSMHAKKVFTLRLKSQRNLQSPQSS
RTTLLVELSCEDRSYWVRDKRLPPCSLSQALTHFLDITTPPTPLLLRKLAQLATEEAERQ
RLETLCQPSEYNKWKFTNSPTFLEVLEEFPSLRVSAGFLLSQLPILKPRYYSISSSRDRT
PTEVHLTVAVLTYRTRDGQGPLHHGVCSTWLSSLKPQDPVPCFVRSAGNFQLPEDPSHPC
ILIGPGTGIAPFRGFWQQRLHDTKYKGLQAGRMTLVFGCRRPGEDHLYREEMLEMAQNGV
LHEVHTAYSRLPGQPKVNAAAACLLASEVLRVLHKEHGHLYVCGDVRMARDVAHTLKLLV
AAKLRLSEEQVEDYFFQLKSQKRYHEDIFGAVFPYEVKKDGAAKQPSDPKVTTAYGRS
NT seq 3237 nt   +upstreamnt  +downstreamnt
atgctggctgtttccttttacagtctagtgacacaggatgaccccaagtgtcacagcctc
ggcaagcaccggaatgagtccccccagtcgctcacagggacagtaaagacgtctccagaa
tccctgatcaagctggattcacccccatcggcctgcccgcggcatgtgaggatcaaaaac
tggggcagtggaatgaccttccaagacacacttcaccataaggccaaaggggatatcgct
tgcaagtccaagtcttgtctgggagccatcatgaaccccaaaagtttgaccagaggaccc
agggacaagcctacccccccagacgagcttctgcctcaagctattgaatttgtcaaccaa
tattatggttccttcaaagaggcaaaaatagaggaacatctggccagggtggaagcggta
acaaaggagatagaaacaacaggaacctatcagctgacgggggatgagctcatcttcgcc
accaagcaggcctggcgcaacgctccccgctgcatcgggaggatccagtggtccaacctg
caggtcttcgacgcccggagctgttccactgccaaggaaatgttcgagcacatctgcaga
cacctgcggtatgccaccaacaacggcaacatcaggtcggccatcaccgtgttcccccag
cggagcgatgggaagcatgacttccgggtctggaatgctcagctcattcggtatgccggc
taccagatgcctgatggcaccatcctgggggaccccgccagcgtggagttcacccagctg
tgcatcgacctgggctggaagcccaagtacagtcgcttcgacgtggtgcccctggtgctg
caggcggatggccaagatccagagttcttcgaaatcccacctgaccttgtgctcgaggtg
cccatggaacatcccaagtacgagtggttccgtgagctccagctgaagtggtatgccctg
cccgcagtggccaacatgctgcttgaggtgggcggcctcgagttcccggggtgccccttc
aacggctggtacatgggcacggagatcggggtccgggacttctgtgacgttcagcgttac
aacattctggaggaagtgggcagaaggatgggcctggaaacgcacaagctggcctcactc
tggaaggaccgggctgtcgttgagatcaatgtcgctgtgctccacagtttccagaagcgg
aatgtgagcatcatggaccaccactcagctgcagagtcgttcatgaagtacatgcagaac
gagtaccgttcccgagggggctgcccggccgactggatttggctggtccccccgatttct
gggagcatcactcctgtgttccaccaggagatgctaaactatgtcctgtcccctttctac
tactaccaggtggaagcctggaaaacccacacctggcaggatgagaagcggagaccccgg
agaagaaagattccattcaaagtcttggtgaaagctgtgctcttctccgccatgctgatg
tgcaagaccatggcttcccgagtcagagccacaatcctctttgcgacggagacaggaaag
tcagaaacgctggcccgggacctgggggccttgttcagctgcgcctttaatcccaaggtt
ctctgcatggacgagtataggctgcgccatctggaggacgagcagctgctcctggtggtg
accagcacgtttgggaatggagactcccctggcaacggagagaaactgaaaaaatctctc
ttcttgctgaaagagcttaccaacaagttcaggtatgccgtgttcggcctcggctccagc
atgtaccctcagttctgtgcctttgctcatgacatcgaccagaagctgtcccatctgggg
gcctctcagcttgccccaacaggggaaggggacgagctcagtgggcaggaggaagccttc
cgcagctgggccgtgcaaacctttaaggcggcctgtgagacgttcgaggtgcgaggcaaa
caccgcattcagatccccaggctctacacctgcaacgtgacatgggacccacagcactac
aggctcgtgcaggactcgcagcctctggacctcgagagagccctcagcagtatgcatgcc
aagaaggtgttcaccctgaggctgaaatcacagcggaatctacagagtccccagtccagc
cgcaccaccctcctggtggagctctcctgtgaggacagaagctactgggtcagagataag
cggctgcccccgtgctcactcagccaggccctcacccacttcctggacatcaccaccccc
ccaaccccgctgctgctccgaaagctggcacagctggccacggaagaggccgagaggcag
aggctagagaccctgtgccagccctcagaatacaacaagtggaagttcaccaacagcccc
acattcctggaggtgctggaggagttcccgtccctgcgggtgtctgctggcttcctgctc
tcccagctccctattctgaaaccccggtactactccatcagctcctccagggatcgcaca
cccacggaggtgcacctcaccgtggccgtgctcacgtaccgcacccgagatggccaaggt
cccttgcaccacggtgtctgtagcacgtggctcagtagcctgaagccccaagacccagta
ccctgcttcgtgagaagtgccggcaacttccagctccctgaggacccctcccatccttgc
atcctcatcggacctggcacaggcatcgcccctttccgcggtttctggcagcagcggctc
catgacaccaagtacaaagggctccaggccggccgcatgaccctggtgttcgggtgccgc
cgcccaggtgaggaccacctgtatcgggaggagatgctggagatggcccagaatggggta
ctgcatgaggtgcacacagcctactctcgcctgcctggccagcccaaggtaaacgcggca
gcggcctgtctactggccagcgaggtgctccgcgtgctgcacaaggagcacggccacctt
tatgtctgtggggacgtgcgtatggcccgggatgtggcccataccctgaagctcctggtg
gctgccaagctgaggctgagtgaggagcaggtggaggactactttttccagcttaagagc
cagaagcgctatcatgaagatatctttggtgctgtgtttccctacgaggtgaaaaaagat
ggggcagcgaagcagcccagcgatcccaaagttacaacagcctacgggagaagttaa

DBGET integrated database retrieval system