KEGG   Ursus maritimus (polar bear): 103668810
Entry
103668810         CDS       T03271                                 

Gene name
CREBBP
Definition
(RefSeq) CREB binding protein
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04024  cAMP signaling pathway
umr04066  HIF-1 signaling pathway
umr04068  FoxO signaling pathway
umr04110  Cell cycle
umr04310  Wnt signaling pathway
umr04330  Notch signaling pathway
umr04350  TGF-beta signaling pathway
umr04520  Adherens junction
umr04630  JAK-STAT signaling pathway
umr04720  Long-term potentiation
umr04916  Melanogenesis
umr04919  Thyroid hormone signaling pathway
umr04922  Glucagon signaling pathway
umr04935  Growth hormone synthesis, secretion and action
umr05016  Huntington disease
umr05152  Tuberculosis
umr05161  Hepatitis B
umr05164  Influenza A
umr05165  Human papillomavirus infection
umr05166  Human T-cell leukemia virus 1 infection
umr05167  Kaposi sarcoma-associated herpesvirus infection
umr05200  Pathways in cancer
umr05203  Viral carcinogenesis
umr05206  MicroRNAs in cancer
umr05211  Renal cell carcinoma
umr05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103668810 (CREBBP)
   04330 Notch signaling pathway
    103668810 (CREBBP)
   04350 TGF-beta signaling pathway
    103668810 (CREBBP)
   04630 JAK-STAT signaling pathway
    103668810 (CREBBP)
   04066 HIF-1 signaling pathway
    103668810 (CREBBP)
   04068 FoxO signaling pathway
    103668810 (CREBBP)
   04024 cAMP signaling pathway
    103668810 (CREBBP)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103668810 (CREBBP)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    103668810 (CREBBP)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    103668810 (CREBBP)
   04935 Growth hormone synthesis, secretion and action
    103668810 (CREBBP)
   04919 Thyroid hormone signaling pathway
    103668810 (CREBBP)
   04916 Melanogenesis
    103668810 (CREBBP)
  09156 Nervous system
   04720 Long-term potentiation
    103668810 (CREBBP)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103668810 (CREBBP)
   05206 MicroRNAs in cancer
    103668810 (CREBBP)
   05203 Viral carcinogenesis
    103668810 (CREBBP)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    103668810 (CREBBP)
   05215 Prostate cancer
    103668810 (CREBBP)
  09164 Neurodegenerative disease
   05016 Huntington disease
    103668810 (CREBBP)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    103668810 (CREBBP)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103668810 (CREBBP)
   05161 Hepatitis B
    103668810 (CREBBP)
   05164 Influenza A
    103668810 (CREBBP)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103668810 (CREBBP)
   05165 Human papillomavirus infection
    103668810 (CREBBP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:umr03000]
    103668810 (CREBBP)
   03036 Chromosome and associated proteins [BR:umr03036]
    103668810 (CREBBP)
   03029 Mitochondrial biogenesis [BR:umr03029]
    103668810 (CREBBP)
Enzymes [BR:umr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     103668810 (CREBBP)
Transcription factors [BR:umr03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain CBP
    103668810 (CREBBP)
Chromosome and associated proteins [BR:umr03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    103668810 (CREBBP)
Mitochondrial biogenesis [BR:umr03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    103668810 (CREBBP)
SSDB
Motif
Pfam: HAT_KAT11 KIX DUF902 zf-TAZ Bromodomain ZZ KIX_2
Other DBs
NCBI-GeneID: 103668810
NCBI-ProteinID: XP_008695338
UniProt: A0A384CKJ2
LinkDB
Position
Un
AA seq 1931 aa
MVGLLDFGSLFDLENDLPDELIPNGGELSLLNSGNLVPDAASKHKQLSELLRGGSGSSIN
PGIGNVSASSPVQQGLGGQAPGQPNSANMASLGAMGKSPLNQGDSAAPSLPKQAASTSGP
TPPASQALNPQAQKQVGLVTSSPATSQTGPGICMNANFNQTHPGLLNSNSGHSLMNQAQQ
GQAQVMNGSLGAAGRGRGAGMPYPAPAMQGATSSVLAETLTQVSPQMAGHAGLNTAQAGG
MTKMGMTGNTSPFGQPFSQTGGQQMGAPGVNPQLSSKQSMVNSLPPFPTDIKNASVTNVP
NMSQMQTSVGIVPTQAIAAGPTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRACSLP
HCRTMKNVLNHMTHCQAGKACQVAHCASSRQIISHWKNCTRHDCPVCLPLKNASDKRNQQ
TILGSPASGIQNTIGSVGTGQQNAASLSNPNPIDPSSMQRAYAALGLPYLNQPQTQLQPQ
VPGQQPAQPPTHQQMRTLNPLGNNPMNIPAGGITTDQQPPNLISESALPTSLGATNPLMN
DGSSPANIGTLSTIPTAAPPSSTGVRKGWHEHVTQDLRSHLVHKLVQAIFPTPDPAALKD
RRMENLVAYAKKVEGDMYESANSRDEYYHLLAEKIYKIQKELEEKRRSRLHKQGILGNQP
ALPAPGAQPPGIPQAQPVRPPNGPMPLPVNRVQVSQGMNSFTPMSLGNVQLPQAPMGPRA
ASPMNHSVPMNSMGSVPGMAISPSRMPQPPNMMGAHANNIMAQAPAQNQFLPQNQFQSSS
GAMSVNSVGMGQPAAQTGVPQGQVPGAALPNPLNMLGPQASQLPCPPVTQSPLHQTPPPA
STAAGMPSLQHPTAPGMTPPQPAAPTQPSTPASSSGQTPTPTPGSVPSASQTQSTPTVQA
AAQAQVTPQPQTPVQPPSVATPQSSQQQPTPVHAQPPGTPLSQAAASIDNRVPTPSSVAS
AETNSQQPGPDVPMLEVKAEVKTEDTEPDASESKGEPGSAMMEEDLQGSSQVKEETDTTE
QKSEPMEVDEKKPEVKVEAKEEEENNANGAASQSTSPSQPRKKIFKPEELRQALMPTLEA
LYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLM
FNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLGYCCGRKYEFSPQTLCCYGKQLCT
IPRDAAYYSYQNRYHFCEKCFTEIQGENVTLGDDPSQPQTTISKDQFEKKKNDTLDPEPF
VDCKECGRKMHQICVLHYDIIWPSGFVCDNCLKKTGRTRKENKFSAKRLQTTRLGNHLED
RVNKFLRRQNHPEAGEVFVRVVASSDKTVEVKPGMKSRFVDSGEMSESFPYRTKALFAFE
EIDGVDVCFFGMHVQEYGSDCPPPNTRRVYISYLDSIHFFRPRCLRTAVYHEILIGYLEY
VKKLGYVTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAFAERIIHDYK
DIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKKEESTAASETTEGSQG
DSKNAKKKNNKKTNKNKSSISRANKKKPSMPNVSNDLSQKLYATMEKHKEVFFVIHLHAG
PVINTLPPIVDPDPLLSCDLMDGRDAFLTLARDKHWEFSSLRRSKWSTLCMLVELHTQGQ
DRFVYTCNECKHHVETRWHCTVCEDYDLCINCYNTKSHAHKMVKWGLGLDDEGSSQGEPQ
SKSPQESRSMGQMAAQMGQLGQMGQPGLGADSTPNIQQALQQRILQQQQMKQQIGSPGQP
NPMSPQQHMLSGQPQASHLPGQQMATSLSSQVRSPAPVQSPRPQSQPPHSSPSPRIQPQP
SPHHVSPQTGSPHPGLAVTMASSIDQGHLGNPEQSAMLPQLNTPNRSALSSELSLVGDTT
GDTLEKFVEGL
NT seq 5796 nt   +upstreamnt  +downstreamnt
atggttggactgctagattttggatcattgtttgacttggaaaatgatcttcctgatgag
ctgatccccaatggaggagaattaagccttttaaacagtgggaaccttgttccagatgct
gcttccaaacataaacaactgtcggagctcctgcgcggaggcagcggctccagtatcaac
ccaggaataggaaatgttagcgccagcagccccgtgcagcaaggccttggcggccaggct
ccagggcagccgaacagtgcaaacatggccagcttgggtgccatgggcaagagccctctg
aaccagggagattctgcagcccccagcctgcccaaacaggcagccagcacctctgggccc
actcctcctgcttcccaagcactgaatccgcaagcacaaaagcaagtggggctggtgacc
agcagccctgccacgtcgcagacgggacctgggatctgcatgaatgctaactttaaccag
acccacccaggcctcctcaatagtaactctggccatagtttaatgaaccaggcccagcaa
ggacaggcgcaagtcatgaatggatctcttggggccgctggcagaggaaggggagctggg
atgccataccctgctccggccatgcagggggccacgagcagcgtgctggccgagacgtta
acacaggtttcaccacaaatggccggtcacgctggactgaacacagcgcaggcaggaggc
atgaccaagatgggaatgactggtaacacaagtccattcggacagccctttagtcaaact
ggagggcagcaaatgggagcccctggagtgaacccccagttatccagcaaacagagcatg
gtcaatagtttgcctcccttccctacagacatcaagaatgcttcagtcaccaatgtgcca
aacatgtctcagatgcagacttcggtgggaattgtccccacacaggcgatagccgcgggc
cccactgcagatccggagaagcgcaaactgatacagcagcagctggtcctcctgcttcac
gctcataagtgtcagagacgagaacaagcgaatggagaggttcgggcctgctctctccca
cattgtcgaaccatgaaaaatgttttgaatcacatgacacactgtcaggctgggaaagcc
tgtcaagttgcccattgtgcatcttcacgacaaatcatctctcattggaagaactgcaca
cgacatgactgtcctgtttgcctccctttgaaaaatgccagtgacaagcgaaaccaacaa
accatcctggggtctccagctagtgggattcagaacacgattggttctgttggcacaggc
cagcagaatgctgcgtctttaagtaacccaaatcccatagaccccagctccatgcagcgc
gcgtacgctgccctcggactcccctacctgaaccagccccagacacagctgcagcctcag
gtccccggccagcaaccagcacagcctccaactcaccagcagatgaggaccctcaacccc
ctgggaaataacccaatgaacattccagcaggaggaataacaacagatcagcagccacca
aacttgatttcagaatcagctcttccaacttcccttggggccacaaatccactgatgaac
gatggctcaagccctgcaaacattgggaccctcagcaccatacctacagcggccccacct
tccagcaccggtgttcggaaaggctggcacgaacatgttactcaggacctgcggagccat
ctagtgcataaactcgtccaagccatctttccaacccctgacccggcagccctgaaggac
cgccgcatggagaacctggtggcctacgccaagaaagtggagggggacatgtacgagtct
gccaacagcagggatgaatactatcatttactggcagaaaaaatctacaagatacaaaaa
gaactagaagaaaaacggaggtcgcgtttgcacaaacaaggcatcttgggtaaccagccc
gccctgccggctcccggggcacagcccccagggattccacaggcacagcctgtgaggcct
ccaaacggacccatgcccctgccagtgaaccgcgtgcaggtgtcccaagggatgaattca
tttaccccaatgtccttggggaatgtacagttgccacaagctcccatgggaccgcgtgca
gcatcccccatgaaccactctgtcccgatgaacagcatgggctccgttcccgggatggcc
atttctccttcccgaatgcctcagcctccaaacatgatgggcgctcacgccaacaacatt
atggcccaggcacctgcgcagaaccagttcctgccacagaaccagttccagtcctccagt
ggggcgatgagtgtgaacagcgtgggcatgggtcagccggcggcccagacaggcgtgcca
cagggacaggtgcctggtgctgctcttcctaaccctctgaacatgcttgggccccaggcc
agccagctgccctgcccaccagtgacacagtcaccgttgcaccagacgccacctcctgct
tccacggccgctggcatgccatctctccagcacccgacggcacctgggatgacccctccc
cagccagcagctcccacccagccatcgactcccgcgtcgtcttccgggcagactcccacc
ccgactcccggctcagtgcccagtgctagccaaacccagagcacccctacggtccaggca
gcagcccaggcccaggtgaccccacagcctcagaccccagtccagcccccgtctgtggcc
accccgcagtcatcacagcaacagccgacacctgtgcacgcccagcctcctggcacaccg
ctttcccaggcagcagccagcatcgataacagggtccccactccttcctcggtggcgagc
gccgaaaccaactcccagcagccaggacccgatgtaccaatgctggaggtgaaggcagag
gtcaagaccgaggacactgagcctgacgccagtgaatccaagggggagcctggatctgcg
atgatggaggaggatctacaaggatcttctcaagttaaagaagaaacagacacaacagaa
cagaaatcagaaccaatggaagtggacgagaagaaaccggaagtcaaagtagaagctaaa
gaggaagaagagaacaacgctaatggagctgcctctcagtcaacgtctccctcacagcca
cgcaaaaaaatctttaagccggaggagttacgccaggctctgatgccaaccctcgaagcg
ttgtatcgacaggatccggagtccctaccttttcggcagcctgtagacccccagctccta
ggaattccggattattttgacattgtgaagaatcccatggacctttccaccatcaagcgg
aagctggatacagggcagtaccaagagccctggcagtatgtggacgatgtctggcttatg
ttcaacaatgcctggctctataatcgtaagacgtcgcgggtctataagttctgcagtaaa
cttgcagaggtctttgaacaagaaattgaccctgttatgcagtcccttggatattgctgt
ggacgaaagtatgagttttccccacagactttgtgctgctacgggaagcagctgtgtaca
attcctcgtgacgctgcctactacagctatcagaataggtatcatttctgtgagaagtgt
ttcacagagatccagggggagaatgttaccctgggtgacgacccttcacagccccagacg
acaatttcaaaggatcagtttgaaaagaagaaaaatgataccttagatcctgaacctttt
gtcgattgcaaggagtgtggccggaagatgcatcagatttgtgttctacactatgacatc
atttggccttcaggctttgtgtgcgacaactgtttgaagaaaactggcagaactcggaaa
gaaaacaagttcagtgctaagagactacagaccacacgattgggcaaccacttggaagac
cgagtcaacaagtttttgcggcgacagaatcatcctgaagccggggaggtctttgtccgt
gtggtggccagctcagacaagactgtggaagtcaagcctgggatgaagtcacggttcgtg
gattctggggaaatgtctgaatctttcccatatcgaaccaaagcactctttgcttttgag
gaaattgatggagtggatgtgtgcttctttgggatgcatgtgcaggagtacggctctgac
tgcccccctccaaacacaaggcgtgtgtacatatcttacctggacagtattcatttcttc
cggccccgatgcctccggacagctgtttaccatgagatccttattggatatttagaatac
gtgaagaaattggggtatgtaacaggacacatctgggcctgccccccaagtgaaggagac
gactatatcttccattgccacccccctgatcagaaaatccccaaaccaaagcgcctccag
gagtggtacaagaagatgctggacaaggcgtttgcggagcggatcattcacgactacaag
gacattttcaaacaagcaactgaggacaggctcaccagcgccaaggagctgccctatttt
gagggtgacttctggcctaatgtgctggaggagagcattaaggagctggagcaagaagaa
gaggagaggaagaaggaggagagcactgcggccagcgagaccacagagggcagccagggt
gacagcaagaatgccaagaagaaaaacaacaagaaaaccaacaagaataaaagcagcatc
agtcgagccaacaagaagaagcccagcatgcccaacgtgtccaacgacttgtcccagaag
ctctatgccaccatggagaagcacaaagaggtcttctttgtgatccacctgcatgctggg
cctgtcatcaacacactgccccccatcgttgaccctgaccccctgctcagctgtgacctc
atggacgggcgtgacgccttcctcaccctcgccagagataagcactgggagttctcctcc
ttgcgccggtccaagtggtccacactgtgcatgctggtggagctgcacacccagggccag
gaccgcttcgtctacacctgcaacgagtgcaagcaccacgtggagacgcgctggcactgc
accgtgtgcgaggactacgacctttgcatcaactgctacaacacgaagagccacgcccac
aagatggtgaagtgggggctgggcctggacgacgagggcagcagccagggcgagccgcag
tccaagagcccccaggagtcgcgctccatgggccagatggcggctcagatgggacagctc
ggccagatggggcagccggggctaggcgcagacagcacccccaacatccagcaggccctg
cagcagcggattttgcagcagcagcagatgaagcagcagattgggtccccgggccagccg
aaccccatgagcccccagcagcacatgctctcaggacagccgcaggcctcgcacctcccc
ggccagcagatggccacgtccctcagtagccaggtgcggtctccggcccctgtccagtct
ccgcggccccagtcccagcctccacattccagcccgtcgccacggatacagccccagcct
tcgccacaccacgtctcgccccagactggttccccccacccaggactcgcagtcaccatg
gccagctccatagatcagggacacttggggaaccccgaacagagtgcaatgctcccacag
ctgaacacccccaacaggagtgcgttgtccagtgagctgtccctggtcggcgacaccaca
ggagacaccctagaaaagttcgtggagggtttgtag

KEGG   Ursus maritimus (polar bear): 103674159
Entry
103674159         CDS       T03271                                 

Gene name
EP300
Definition
(RefSeq) E1A binding protein p300
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04024  cAMP signaling pathway
umr04066  HIF-1 signaling pathway
umr04068  FoxO signaling pathway
umr04110  Cell cycle
umr04310  Wnt signaling pathway
umr04330  Notch signaling pathway
umr04350  TGF-beta signaling pathway
umr04520  Adherens junction
umr04630  JAK-STAT signaling pathway
umr04720  Long-term potentiation
umr04916  Melanogenesis
umr04919  Thyroid hormone signaling pathway
umr04922  Glucagon signaling pathway
umr04935  Growth hormone synthesis, secretion and action
umr05016  Huntington disease
umr05152  Tuberculosis
umr05161  Hepatitis B
umr05164  Influenza A
umr05165  Human papillomavirus infection
umr05166  Human T-cell leukemia virus 1 infection
umr05167  Kaposi sarcoma-associated herpesvirus infection
umr05200  Pathways in cancer
umr05203  Viral carcinogenesis
umr05206  MicroRNAs in cancer
umr05211  Renal cell carcinoma
umr05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103674159 (EP300)
   04330 Notch signaling pathway
    103674159 (EP300)
   04350 TGF-beta signaling pathway
    103674159 (EP300)
   04630 JAK-STAT signaling pathway
    103674159 (EP300)
   04066 HIF-1 signaling pathway
    103674159 (EP300)
   04068 FoxO signaling pathway
    103674159 (EP300)
   04024 cAMP signaling pathway
    103674159 (EP300)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103674159 (EP300)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    103674159 (EP300)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    103674159 (EP300)
   04935 Growth hormone synthesis, secretion and action
    103674159 (EP300)
   04919 Thyroid hormone signaling pathway
    103674159 (EP300)
   04916 Melanogenesis
    103674159 (EP300)
  09156 Nervous system
   04720 Long-term potentiation
    103674159 (EP300)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103674159 (EP300)
   05206 MicroRNAs in cancer
    103674159 (EP300)
   05203 Viral carcinogenesis
    103674159 (EP300)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    103674159 (EP300)
   05215 Prostate cancer
    103674159 (EP300)
  09164 Neurodegenerative disease
   05016 Huntington disease
    103674159 (EP300)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    103674159 (EP300)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103674159 (EP300)
   05161 Hepatitis B
    103674159 (EP300)
   05164 Influenza A
    103674159 (EP300)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103674159 (EP300)
   05165 Human papillomavirus infection
    103674159 (EP300)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:umr03000]
    103674159 (EP300)
   03036 Chromosome and associated proteins [BR:umr03036]
    103674159 (EP300)
   03029 Mitochondrial biogenesis [BR:umr03029]
    103674159 (EP300)
Enzymes [BR:umr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     103674159 (EP300)
Transcription factors [BR:umr03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain CBP
    103674159 (EP300)
Chromosome and associated proteins [BR:umr03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    103674159 (EP300)
Mitochondrial biogenesis [BR:umr03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    103674159 (EP300)
SSDB
Motif
Pfam: HAT_KAT11 KIX Creb_binding zf-TAZ DUF902 Bromodomain ZZ KIX_2 Npa1
Other DBs
NCBI-GeneID: 103674159
NCBI-ProteinID: XP_008701246
UniProt: A0A384D2M5
LinkDB
Position
Un
AA seq 2343 aa
MAENVVEPGPPSAKRPKLSSPALSASASDGTDFGSLFDLEHDLPDELINSTELGLTNGGD
ISQLQTSLGIVQDAASKHKQLSELLRSGSSPNLNMGVGGPGQGMASQPQQNSPGLGLINS
MVKSPMAQAGLTSPNMGMGTSGPNQGPTPSAAGMMNSPVNQPAMGMNTGMNAGMNPGMLN
AGNGQGMMPNQVMNGSIGAGRGRPNMQYPNPGMGNAGNLMTEPLQQGSPQMGGQTGLRGP
QPLKMGMMNNPNPYGSPYTQNSGQQIGAGGLGLQIQTKSVLPNNLSPFAMDKKAVPGGGM
PNMGQQQAPQVQQPGLVTPVAQGMGSGAHTADPEKRKLIQQQLVLLLHAHKCQRREQANG
EVRQCNLPHCRTMKNVLNHMTHCQSGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKN
AGDKRNQQSILTGAPVGLGNTSSLGVGQQSTPSLSTVSQIDPSSIERAYAALGLPYQVNQ
MPTQPQVQAKNQQNQQSGQSPQGMRPMSNMSASPMGVNGGVGVQTSNLLSDSMLHSAINS
QNPMMSENASVASLGPMPTAAQPSNTGIRKQWHEDITQDLRNHLVHKLVQAIFPTPDPAA
LKDRRMENLVAYARKVEGDMYESANNRAEYYHLLAEKIYKIQKELEEKRRTRLQKQNMLP
SAAGMVPVSMNPGPNMGQPQPGMTSNGPLPDPSMIRGSVPNQMMPRITPQPGLNQFGQMS
MPQPPIGPRQTSPLQHHGQLAQPGTLNPPMGYGPRMQQPSSQSQFLPQTQFSTQGMNVTN
MPLAPSGGQAPVSQAQMSSSSCPVNSPIMPPGSQGSHIHCPPLPQSALHQNSPSPVPSRT
PTPHHTPPSIGAQQPPATAIPAPVPTPPAMPPGPQTQALHPPPRQTPTPPPTQLPPQVQP
SLPAAPSADQPPQQPLSQQSTAASVPTPTAPLLPPQPATPLSQPAVSIEGQVSNPPSTSS
TEVNSQTIPEKQPSQEVKMEAKMEVDPPEPADAQPEDIPETKAEDCKMEPTETEERGTEL
KTETKEEEDQPSTSATQSSPAPGQSKKKIFKPEELRQALMPTLEALYRQDPESLPFRQPV
DPQLLGIPDYFDIVKSPMDLSTIKRKLDTGQYQEPWQYVDDIWLMFNNAWLYNRKTSRVY
KYCSKLSEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATYYSYQNRYH
FCEKCFNEIQGESVSLGDDPSQPQTTINKEQFSKRKNDTLDPELFVECTECGRKMHQICV
LHHEIIWPSGFVCDGCLKKSARTRKENKFSAKRLPSTRLGTFLENRVNDFLRRQNHPESG
EVTVRVVHASDKTVEVKPGMKARFVDSGEMAESFPYRTKALFAFEEIDGVDLCFFGMHVQ
EYGSDCPPPNQRRVYISYLDSVHFFRPKCLRTAVYHEILIGYLEYVKKLGYTTGHIWACP
PSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAVSERIVHDYKDIFKQATEDRLTSAK
ELPYFEGDFWPNVLEESIKELEQEEEERKREENTSNESTDVTKGDSKNAKKKNNKKTSKN
KSSLSRGNKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLIAGPAANSLPPIVDPDPLI
PCDLMDGRDAFLTLARDKHLEFSSLRRAQWSTMCMLVELHTQSQDRFVYTCNECKHHVET
RWHCTVCEDYDLCITCYNTKNHDHKMEKLGLGLDDESNSQQAPATQSPGDSRRLSIQRCI
QSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQEN
KCPVPFCLNIKQKLRQQLQQHXQAQMLRRRMASMQRTGVVGQQQGLPSPTPATPTTPTGQ
QPATPQTPQPQPPSQPQPTPPNSMPPYLPRTQAAGPVSQGKAEGQGTPPTPPQTAQPPLP
GPPPAAVEMAMQIQRAAETQRQMAHVQIFQRPIQHQMPQMTPMAPMGMNPPPMTRGPSGH
LEPGMGPTGMQQQPQWVQGGLPQPQQLQPGMPRPAMMSVAQHGQPLNIAPQPGLGQVGVS
PLKPGTVSQQALQNLLRTLRSPSSPLQQQQVLSILHANPQLLAAFIKQRAAKYASSNPQP
LAGQPGMPQGQPGLQPPAIPGQQGPGIGPGMANHNQFQQPQGVGYPPPPQPQQQRMQHHL
QQMQPGSMGQMGQLPQALGAEAGAGLQAYQQRLLQQQMGSPAQPNPMSPQQHMLPSQAQS
PHLQGQQIPSSLSNQVRSPQPVPSPRPQSQPPHSSPSPRMQPQPSPHHVSPQTSSPHPGL
VAAQANPMEQGHFASPDQSSMLSQLASNPGMANLHGAGATDLGLGPDNADLNSNLSQSTL
DIH
NT seq 7032 nt   +upstreamnt  +downstreamnt
atggccgagaatgtggtggaaccggggccgccttcagccaagcggcctaaactctcatct
ccggccctctcggcgtcggccagcgatggcacagattttggctctctatttgatttggag
catgacttaccagatgaattaatcaactctacagaattgggactaaccaatggtggtgat
attagtcagcttcagacaagtcttggcatagtacaagatgcagcctctaaacataaacag
ctgtcagagttgctacggtctggtagttcccctaacctcaatatgggggttggtggccca
ggccaaggcatggccagccagccccaacagaacagtcctggattaggtttgataaatagc
atggttaaaagcccaatggcacaggcaggcttgacttctcccaacatggggatgggcacc
agtggaccaaatcaaggtcctacgccatctgcagcaggtatgatgaacagtccagtaaat
cagcctgccatgggaatgaacacagggatgaatgctggcatgaatcctggaatgttgaat
gcaggcaatggacaggggatgatgcctaatcaagtcatgaacggttcaattggagcaggc
cgggggcgacccaatatgcagtacccaaacccaggcatgggaaatgctggcaatttaatg
accgagccactgcagcaaggctctcctcagatgggaggacaaacgggattgagaggccct
cagcctcttaagatgggaatgatgaacaaccctaatccttacggttcaccatacactcag
aattctggacagcagattggagccggtggccttggtctccagattcagacaaagtctgta
ctaccaaataacttatctccatttgcaatggacaaaaaggcagttcctggtggaggaatg
cccaacatgggtcaacagcaggccccacaagtccagcagccaggccttgtgactccagtg
gcccaagggatgggttctggagcacatacagctgatccagagaagcgcaagctcatccag
cagcagcttgttcttcttttacatgctcataagtgccagcgccgggagcaggctaatggg
gaagtgaggcagtgcaaccttccccactgtcgcacaatgaagaacgtcctaaaccacatg
acacactgccagtcaggcaagtcctgccaagtggcacactgtgcatcttctcgacaaatc
atttcacactggaagaattgtacaaggcatgattgtcctgtgtgtctcccccttaaaaat
gctggagataagagaaatcagcagtcaattctgactggagcaccagttggacttggaaat
actagctctctaggtgtgggtcaacagtctacccctagcctaagcactgttagtcagatt
gatcccagctctatagaaagggcctatgcagctcttggtctgccctatcaagtaaatcag
atgccgacgcagccccaggtacaagcaaagaaccagcagaatcagcagtctgggcagtct
ccccaaggcatgcggcccatgagcaacatgagtgctagtcctatgggagtaaatggaggt
gtaggggttcaaacgtcaaatcttctttctgactcaatgttgcattcagccataaattct
caaaacccaatgatgagtgaaaatgccagtgtggcctccctgggtcctatgccaacagca
gctcaaccatccaatactggaattcggaaacaatggcatgaagatattactcaggatctt
cgaaatcatcttgttcacaaacttgttcaagccatatttcctactccggatcctgctgct
ttaaaagacagacgaatggaaaacttagttgcatatgcccggaaagtggaaggggacatg
tatgaatctgcaaataatcgagcggaatactaccacttgctagctgagaagatctataag
atccagaaagaactagaagaaaaacgaaggactagactacagaaacaaaacatgctgccc
agtgctgcaggcatggtgccagtttctatgaatccagggcccaatatggggcagccacaa
ccaggaatgacttccaatggccctctacctgacccatctatgatccgcggcagtgtgcca
aaccagatgatgcctcggataactccacagcctggtttgaatcagtttggccagatgagt
atgccccagcccccaattggaccccggcaaacctctcctcttcagcaccatggacagtta
gctcagcctggaactctcaacccgcctatgggctatgggcctcgcatgcagcagccttcc
agccagagccagttccttccccagactcagttctcaacacagggaatgaatgtaacgaat
atgcctttggctccgtctggcggtcaagcaccagtgtctcaagcacaaatgtccagttct
tcctgcccagtgaactctcctataatgcctccagggtcgcaagggagccacattcactgt
ccccctctccctcaatcagctctgcatcagaattcaccctctccggtacctagtcgcacc
cctacacctcaccacactcccccaagcataggggctcagcagccaccagcaacagcaatt
ccagcccctgttcctacacctccagccatgccccccgggccgcagacccaggctctacat
ccacctccaaggcagacacccacaccaccaccaacgcagcttcctcctcaagttcagcct
tcacttcctgctgctccttcggctgaccagccaccgcagcagcctctctcacagcagagc
accgcagcatctgttcccaccccaacggcgccgctgctgcccccacagcctgcgactcca
ctttcccaaccagctgtaagcattgaaggtcaggtatcaaatcctccatccactagtagc
acagaagtgaattctcagaccattcctgagaagcagccgtcacaggaagtgaaaatggag
gcaaagatggaagtggatccaccagaaccagcagatgctcagccagaggatattccagag
actaaagcagaagactgtaaaatggaacctacagaaacagaagagagaggcactgaatta
aaaactgaaacaaaagaggaggaagaccagccaagtacttcagctacacagtcatctcca
gccccgggacagtcaaagaagaagattttcaaaccagaagagttacgacaggcactgatg
ccaactttggaggcactttaccgacaggatccggaatccctaccctttcgtcaacctgtg
gaccctcaacttctaggaatccctgattattttgatattgtgaagagccccatggacctt
tctaccatcaagaggaagttagacactggacagtatcaggagccctggcagtatgtggat
gacatttggcttatgttcaacaatgcctggttgtataatcggaaaacatctcgggtatac
aaatactgctccaagctgtctgaagtctttgaacaagaaattgacccagtaatgcaaagc
ctcggatattgttgtggcagaaagttggagttctctccacagacactctgttgctatggc
aaacagttatgcacaatccctcgtgatgccacttactacagttaccagaacaggtatcat
ttctgtgagaagtgtttcaatgaaatccaaggggagagcgtttctttgggggatgaccct
tcccagcctcaaactacgataaataaagaacagttttccaagagaaaaaatgacacactg
gatcctgaattatttgttgaatgtacagagtgtggaagaaagatgcatcagatctgtgtt
cttcatcatgaaattatctggccatctggatttgtttgtgatggctgcttaaagaaatct
gcacgaaccaggaaagaaaataagttttctgctaaaaggttgccatctaccaggcttggc
acctttctggagaatcgtgtaaatgactttcttaggcgacagaatcaccccgagtccggg
gaagtcactgttcgggtagttcatgcttctgacaaaactgtggaagtgaaaccaggaatg
aaagcaaggtttgtagatagtggagagatggcagaatcctttccataccgaaccaaagcc
ctctttgcctttgaagagatcgacggtgttgacttgtgtttctttggcatgcacgttcaa
gagtatggctctgactgccctccacccaaccagaggagagtttacatttcataccttgac
agtgttcatttcttccgtcctaaatgcttgaggactgcagtctatcatgaaattctaatt
ggatatttagaatacgtcaagaaattagggtacacaacagggcatatttgggcttgtccc
ccaagtgagggagacgactatatcttccattgccatcctcctgaccagaagatacccaag
cccaagcgactgcaggagtggtacaaaaagatgcttgacaaggccgtgtctgagcgaatc
gtccatgactacaaggatatttttaaacaagcgactgaagatcgactaacaagcgcaaag
gagctgccttactttgagggcgatttctggcccaacgttctggaagagagcattaaggaa
ctggaacaggaggaggaagagcgaaagcgagaggagaacaccagcaatgagagcacagat
gtgacgaagggagacagcaaaaatgctaaaaagaaaaataataagaaaaccagcaaaaac
aagagcagcctgagtaggggcaacaagaagaagcccggcatgcctaatgtctccaacgac
ctctcgcagaagctgtacgccacgatggagaagcacaaggaggtcttctttgtgatccgt
ctcatcgctggccctgccgccaactccctgccccccatcgtcgatcccgaccccctcatc
ccctgcgatctgatggatgggcgggacgccttccttaccctcgcaagggacaagcacctg
gagttctcttcactccgaagagcccagtggtccaccatgtgcatgctggtggagctgcac
acccagagccaggaccgctttgtctacacctgcaacgagtgcaagcaccacgtggagacg
cgctggcactgcactgtctgcgaggattatgatctgtgtatcacctgctataacactaaa
aaccatgaccacaaaatggagaaactaggtctgggcttagatgacgagagcaacagccag
caggccccagccacccagagcccgggggactcgcggcgcctgagcatccagcgctgcatc
cagtccctggtgcacgcctgccagtgccgcaacgccaactgctcgctgccgtcctgccag
aagatgaagcgggtggtgcagcacaccaagggctgcaagcggaaaaccaacggcggctgc
cccatctgcaagcagctcatcgccctctgctgctaccacgccaagcactgccaggagaac
aagtgcccggtgcccttctgcctcaacatcaagcagaagctgcggcagcagctgcagcag
cacnnccaggcccagatgctccgcaggaggatggccagcatgcagcggaccggtgtggtg
gggcagcagcaaggcctgccctcccccactcctgccactcccaccactccgacgggccag
cagccggccaccccgcagacgccccagccccagcctccctctcagcctcagcccacgcct
cccaacagcatgcccccctacttgcccaggactcaggctgctggccctgtctcccagggt
aaggcagagggccaggggacccctcccacacccccccagactgctcagccacccctcccg
gggcccccacctgccgcagtggaaatggcaatgcagattcagagggcggctgagacgcag
cgccagatggcccacgtgcaaatttttcaaaggccaatacagcaccagatgccccagatg
actccaatggctcccatgggtatgaacccaccccctatgaccagaggtcccagtgggcat
ttggagccagggatggggcccacagggatgcagcagcagccacagtgggtccaaggaggg
ttgcctcagccccagcagctacagcccgggatgccgaggccagccatgatgtcagtggcc
cagcacggccagcccttgaatatagctccccagccaggactgggccaggtaggtgtgagc
cctctcaaaccaggcactgtgtctcaacaagccttacaaaaccttttgcggactctcagg
tctcccagctctcccctacagcagcaacaggtgctcagtatccttcacgccaacccccag
ctgttggctgcattcatcaagcagcgggctgccaagtacgccagctcgaatccgcagccc
ctcgctgggcagcccggcatgccccagggccagccggggctgcagccacctgccatccct
ggccagcaggggcccgggatcggtcccgggatggccaaccataaccagttccagcaaccg
caaggggtgggctaccccccgccgccacagccgcagcagcagcgcatgcagcaccacctg
cagcagatgcaaccggggagcatggggcagatgggccagctcccccaggccttgggagcg
gaggcgggggccggcctgcaggcgtatcagcaacgactcctccagcagcagatggggtcc
cctgctcagcccaaccccatgagcccccagcagcatatgctcccaagccaggcgcagtcc
ccacacctccaaggccagcagatcccttcttctctctccaatcaagtgcgctctccccag
cctgtcccttctccacggccgcagtcccagcccccccactccagcccttccccaaggatg
cagcctcagccttcgccacaccacgtctccccgcagaccagttctccacatccgggactg
gtcgccgcccaggccaaccccatggaacaagggcattttgccagcccggaccagagctcg
atgctttctcagctcgctagcaatccgggcatggcaaacctccacggtgcgggcgccacg
gacctggggctcggccccgataacgcggacttgaattcgaacctctcgcagagtacgcta
gacatacactag

DBGET integrated database retrieval system