KEGG   Ursus maritimus (polar bear): 103669103
Entry
103669103         CDS       T03271                                 

Gene name
BRAF
Definition
(RefSeq) B-Raf proto-oncogene, serine/threonine kinase
  KO
K04365  B-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01521  EGFR tyrosine kinase inhibitor resistance
umr01522  Endocrine resistance
umr04010  MAPK signaling pathway
umr04012  ErbB signaling pathway
umr04015  Rap1 signaling pathway
umr04024  cAMP signaling pathway
umr04062  Chemokine signaling pathway
umr04068  FoxO signaling pathway
umr04150  mTOR signaling pathway
umr04270  Vascular smooth muscle contraction
umr04510  Focal adhesion
umr04650  Natural killer cell mediated cytotoxicity
umr04720  Long-term potentiation
umr04722  Neurotrophin signaling pathway
umr04726  Serotonergic synapse
umr04730  Long-term depression
umr04810  Regulation of actin cytoskeleton
umr04910  Insulin signaling pathway
umr04914  Progesterone-mediated oocyte maturation
umr04928  Parathyroid hormone synthesis, secretion and action
umr04934  Cushing syndrome
umr05010  Alzheimer disease
umr05022  Pathways of neurodegeneration - multiple diseases
umr05034  Alcoholism
umr05160  Hepatitis C
umr05161  Hepatitis B
umr05200  Pathways in cancer
umr05205  Proteoglycans in cancer
umr05210  Colorectal cancer
umr05211  Renal cell carcinoma
umr05212  Pancreatic cancer
umr05213  Endometrial cancer
umr05214  Glioma
umr05215  Prostate cancer
umr05216  Thyroid cancer
umr05218  Melanoma
umr05219  Bladder cancer
umr05220  Chronic myeloid leukemia
umr05221  Acute myeloid leukemia
umr05223  Non-small cell lung cancer
umr05224  Breast cancer
umr05225  Hepatocellular carcinoma
umr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103669103 (BRAF)
   04012 ErbB signaling pathway
    103669103 (BRAF)
   04015 Rap1 signaling pathway
    103669103 (BRAF)
   04068 FoxO signaling pathway
    103669103 (BRAF)
   04024 cAMP signaling pathway
    103669103 (BRAF)
   04150 mTOR signaling pathway
    103669103 (BRAF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103669103 (BRAF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103669103 (BRAF)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    103669103 (BRAF)
   04062 Chemokine signaling pathway
    103669103 (BRAF)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103669103 (BRAF)
   04914 Progesterone-mediated oocyte maturation
    103669103 (BRAF)
   04928 Parathyroid hormone synthesis, secretion and action
    103669103 (BRAF)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103669103 (BRAF)
  09156 Nervous system
   04726 Serotonergic synapse
    103669103 (BRAF)
   04720 Long-term potentiation
    103669103 (BRAF)
   04730 Long-term depression
    103669103 (BRAF)
   04722 Neurotrophin signaling pathway
    103669103 (BRAF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103669103 (BRAF)
   05205 Proteoglycans in cancer
    103669103 (BRAF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103669103 (BRAF)
   05212 Pancreatic cancer
    103669103 (BRAF)
   05225 Hepatocellular carcinoma
    103669103 (BRAF)
   05226 Gastric cancer
    103669103 (BRAF)
   05214 Glioma
    103669103 (BRAF)
   05216 Thyroid cancer
    103669103 (BRAF)
   05221 Acute myeloid leukemia
    103669103 (BRAF)
   05220 Chronic myeloid leukemia
    103669103 (BRAF)
   05218 Melanoma
    103669103 (BRAF)
   05211 Renal cell carcinoma
    103669103 (BRAF)
   05219 Bladder cancer
    103669103 (BRAF)
   05215 Prostate cancer
    103669103 (BRAF)
   05213 Endometrial cancer
    103669103 (BRAF)
   05224 Breast cancer
    103669103 (BRAF)
   05223 Non-small cell lung cancer
    103669103 (BRAF)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103669103 (BRAF)
   05022 Pathways of neurodegeneration - multiple diseases
    103669103 (BRAF)
  09165 Substance dependence
   05034 Alcoholism
    103669103 (BRAF)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103669103 (BRAF)
  09172 Infectious disease: viral
   05161 Hepatitis B
    103669103 (BRAF)
   05160 Hepatitis C
    103669103 (BRAF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103669103 (BRAF)
   01522 Endocrine resistance
    103669103 (BRAF)
Enzymes [BR:umr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     103669103 (BRAF)
Protein kinases [BR:umr01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   103669103 (BRAF)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like C1_2 Pkinase_fungal APH Kdo
Other DBs
NCBI-GeneID: 103669103
NCBI-ProteinID: XP_008695638
UniProt: A0A384CLE5
LinkDB
Position
Un
AA seq 789 aa
MKSVRLRLKLQGGTAVRVRLLLPQALITVSVMGVLQEKPVITELNMHPIEMVWNIKQMIK
LTQEHIEALLDKFGGEHNPPSIYLEAYEEYTSKLDALQQREQQLLESLGNGTDFSVSSSA
STDTVTSSSSSSLSVLPSSLSVFQNPTDISRSNPKSPQKPIVRVFLPNKQRTVVPARCGV
TVRDSLKKALMMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVEVLENVPLTTH
NFVRKTFFTLAFCDFCRKLLFQGFRCQTCGYKFHQRCSTEVPLMCVNYDQLDLLFVSKFF
EHHPIPQEEASIAETALTSGSSPSAPPSDSTGPQILTSPSPSKSIPIPQPFRPADEDHRN
QFGQRDRSSSAPNVHINTIEPVNIDDLIRDQGFRSDGGSTTGLSATPPASLPGSLTNVKA
LQKSPGPQRERKSSSSSEDRNRMKTLGRRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGK
WHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGS
SLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDF
GLATVKSRWSGSHQFEQLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLP
YSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLVPQERSRRK
YRLFNSGYPWKILASIELLARSLPKIHRSASEPSLNRAGFQTEDFSLYACASPKTPIQAG
GYGEFAAFK
NT seq 2370 nt   +upstreamnt  +downstreamnt
atgaaatcggtgaggctgaggctgaagctacaaggaggcactgcagtgcgagtcaggctg
ttactacctcaggctctcattacagtgtcagtgatgggggtcctgcaggagaagcctgtc
atcacagagttaaacatgcatcccatagaaatggtgtggaatatcaaacaaatgattaag
ttgacacaggaacatatagaagccctattggacaaatttggtggggagcataatccacca
tcaatttatctggaggcctatgaagaatacaccagcaagctagatgccctccaacagcga
gaacaacagttattggaatccctggggaatggaactgatttttctgtttctagctctgca
tcaacggacaccgttacatcttcttcctcttctagcctttcagtgctaccttcatctctt
tcagtttttcaaaatcccacagatatatcaaggagcaatcccaagtcaccacaaaaacct
atcgttagagtcttcctgcccaataaacagaggacagtggtacctgcaagatgtggagtt
acagtccgagacagtctaaagaaagctctgatgatgagaggtctaatcccagagtgctgt
gctgtttacagaattcaggatggagagaagaaaccaattggctgggacactgatatttcc
tggcttaccggagaggaactacatgtagaagtgttggaaaatgttccgcttaccacacac
aactttgtacggaaaacttttttcaccttagcattttgtgacttttgtcgaaagctgctt
ttccagggttttcgctgtcaaacatgtggttataagtttcaccagcgttgtagtacagag
gttccactgatgtgtgttaattatgaccaacttgatttgctgtttgtctccaagttcttt
gaacaccacccaataccacaggaggaggcctccatagcagagactgcccttacgtctgga
tcatccccttctgctcccccctccgattctactgggccccaaattctcaccagtccgtct
ccttcaaaatccattccaattccacagcctttccgaccagcagatgaagatcatcgaaat
caatttggacaaagagaccggtcctcatcagctccaaacgtgcatataaacacaatagaa
cctgtcaatattgatgacttgattagagaccaagggtttcgtagtgatggaggatcaacc
acaggtttgtctgccaccccccctgcctcattgcctggctcactcactaatgtgaaagca
ttacagaaatctccaggacctcagcgggaaaggaaatcatcttcatcctcagaagatagg
aatcgaatgaaaacacttggtagacgagattcaagtgatgattgggaaattcctgatggg
cagatcacagtgggacagagaattggatccgggtcatttgggacagtctacaagggaaag
tggcatggtgatgtggcagtgaaaatgttgaatgtgacagcacccacacctcagcagtta
caggccttcaaaaatgaagtaggagtactcaggaaaactcgacatgtgaatatcctactc
ttcatgggctattcaacgaagccccaactagctattgttacccagtggtgtgagggctcc
agcttatatcaccatctccacatcattgagaccaaatttgagatgatcaagcttatagat
attgcacggcagactgcgcagggcatggattacttacacgccaagtcaatcatccacaga
gacctcaagagtaataatatttttcttcatgaagacctcacagtaaaaataggtgatttt
ggtctagccacagtgaaatctcgatggagtgggtcccatcagtttgaacagttgtctgga
tccattttgtggatggcaccagaagtgatccgaatgcaagataaaaacccatatagcttt
cagtcagatgtctatgcatttgggattgttctatatgaattgatgaccgggcagttacct
tattcaaacatcaacaacagggaccagataatttttatggtgggacgaggatatctttct
ccagatctcagtaaggtacggagtaactgtccaaaagccatgaagagattgatggcagag
tgcctaaaaaagaaaagagatgagaggccactcgttccccaagaaaggtccagaagaaag
tatagactctttaacagtggttacccctggaagattctcgcctctattgagctgctggcc
cgctcattgccaaaaattcaccgcagtgcatcagaaccctccttgaatcgggctggcttc
caaacagaggattttagtctatatgcttgtgcttctccaaaaacacccatccaggcaggg
ggatatggagaatttgcagccttcaagtag

DBGET integrated database retrieval system