KEGG   Ursus maritimus (polar bear): 103669544
Entry
103669544         CDS       T03271                                 

Gene name
PPARG
Definition
(RefSeq) peroxisome proliferator activated receptor gamma
  KO
K08530  peroxisome proliferator-activated receptor gamma
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr03320  PPAR signaling pathway
umr04152  AMPK signaling pathway
umr04211  Longevity regulating pathway
umr04380  Osteoclast differentiation
umr04714  Thermogenesis
umr05016  Huntington disease
umr05200  Pathways in cancer
umr05202  Transcriptional misregulation in cancer
umr05216  Thyroid cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    103669544 (PPARG)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    103669544 (PPARG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103669544 (PPARG)
  09149 Aging
   04211 Longevity regulating pathway
    103669544 (PPARG)
  09159 Environmental adaptation
   04714 Thermogenesis
    103669544 (PPARG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103669544 (PPARG)
   05202 Transcriptional misregulation in cancer
    103669544 (PPARG)
  09162 Cancer: specific types
   05216 Thyroid cancer
    103669544 (PPARG)
  09164 Neurodegenerative disease
   05016 Huntington disease
    103669544 (PPARG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:umr03000]
    103669544 (PPARG)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:umr03310]
    103669544 (PPARG)
Transcription factors [BR:umr03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    103669544 (PPARG)
Nuclear receptors [BR:umr03310]
 1. Thyroid hormone like
  1C. Peroxisome proliferator-activated receptor (PPAR)
   103669544 (PPARG)
SSDB
Motif
Pfam: PPARgamma_N zf-C4 Hormone_recep
Other DBs
NCBI-GeneID: 103669544
NCBI-ProteinID: XP_008696091
UniProt: A0A384CMM7
LinkDB
Position
Un
AA seq 529 aa
MDWSFARNRQNISVNYSKSLFHAVMGETLGDSLIDPESDSFADTLSASTSQEITMVDTEM
PFWPTNFGISSVDLSVMDDHSHSFDIKPFTTVDFSSISTPHYEDIPFARADPMVADYKYD
LKLQEYQSAIKVEPASPPYYSEKTQLYNKPHEEPSNSLMAIXXXXXXXXASGFHYGVHAC
EGCKGFFRRTIRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQA
EKEKLLAEISSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFV
IYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVN
LDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKF
EFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPES
SQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY
NT seq 1590 nt   +upstreamnt  +downstreamnt
atggattggtcttttgcaagaaatagacaaaatatcagtgtgaattacagcaaatccctc
ttccatgctgttatgggtgaaactctgggagattctcttattgacccagaaagcgattcc
tttgctgatacactgtctgcaagcacttcacaagaaattaccatggttgacaccgagatg
ccattttggcccaccaactttggaatcagctccgtggatctctctgtaatggatgaccac
tcccattcttttgacatcaagcccttcaccaccgtggatttctccagcatttccactcca
cactatgaagacattccatttgcaagagcggacccaatggttgctgattacaagtatgac
ctgaagctccaggagtaccaaagtgcaatcaaagtggagcctgcatccccaccttattat
tcggaaaagactcagctgtacaataagcctcatgaagagccttccaactccctcatggca
attnnnnnnnnnnnnnnnnnnnnnnaagcttccgggttccactatggcgttcatgcttgt
gaaggatgcaaggggttcttccggaggacaatcagattgaagctcatttatgataggtgt
gaccttaactgtcggatccataaaaaaagtagaaataaatgtcagtactgtcggtttcag
aaatgccttgctgtggggatgtctcacaatgccatcaggtttgggcggatgccgcaggcc
gagaaggagaagctgttggcggagatctccagcgatatcgaccagctgaacccagagtcg
gctgatctccgggccctggcaaaacatttgtatgactcatacataaagtccttcccgctg
accaaagcaaaggcgagggcgatcttgacaggaaagacaacggacaaatcaccatttgtt
atctatgacatgaattccttaatgatgggagaagataaaatcaagttcaaacacatcacc
cccttgcaggagcagagcaaagaggtggccattcgcatctttcaggggtgtcagttccgc
tcagtggaagctgtgcaggagatcacagagtatgccaaaagtatccctggctttgtaaac
cttgacttgaatgaccaagtaactctcctaaaatatggtgtccatgagatcatttacacg
atgctggcctccttgatgaataaagatggggttctcatatcagagggccaaggattcatg
acaagggagtttctaaagagcctgagaaagccctttggtgactttatggagcccaagttt
gagtttgctgtgaagttcaatgcactggaattagatgacagcgacttggcaatatttata
gccgtcattattctcagtggagaccgcccaggtttgctgaacgtgaagcccattgaggac
atccaggacaacctgctgcaagccttggagctccagctcaagctgaaccaccccgaatcc
tctcagctctttgccaagctgctccagaaaatgacagacctcagacagattgtaacagaa
catgtgcagctattgcaagtcataaagaaaacagagacggacatgagtcttcacccgctc
ctacaagagatatacaaggacttgtattag

KEGG   Ursus maritimus (polar bear): 103671861
Entry
103671861         CDS       T03271                                 

Gene name
PAX8
Definition
(RefSeq) paired box 8
  KO
K09293  paired box protein 8
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04918  Thyroid hormone synthesis
umr05200  Pathways in cancer
umr05202  Transcriptional misregulation in cancer
umr05216  Thyroid cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    103671861 (PAX8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103671861 (PAX8)
   05202 Transcriptional misregulation in cancer
    103671861 (PAX8)
  09162 Cancer: specific types
   05216 Thyroid cancer
    103671861 (PAX8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:umr03000]
    103671861 (PAX8)
Transcription factors [BR:umr03000]
 Eukaryotic type
  Helix-turn-helix
   Paired box domain only
    103671861 (PAX8)
SSDB
Motif
Pfam: PAX Pax2_C HTH_23 HTH_32 HTH_Tnp_IS1
Other DBs
NCBI-GeneID: 103671861
NCBI-ProteinID: XP_008698739
UniProt: A0A384CW58
LinkDB
Position
Un
AA seq 485 aa
MACGHEKPVEGAQKWAIWDVLPAVVEKHVLGQAALCHGGLNQLGGAFVNGRPLPEVVRQR
IVDLAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIRPGVIGGSKPKVATPKVVEKIG
DYKRQNPTMFAWEIRDRLLAEGVCDNDTVPSVSSINRIIRTKVQQPFNLPMDSCVATKSL
SPGHTLIPSSAVTPPESPQSDSLGSTYSINGLLGIAQPGSDSKRKMDDSDQDSCRLSIDS
QSSSSGPRKHPRTDSFSQHHLEPLECPFERQHYPEAYASPSHTKGEQGLYPLPLLNSAAL
DDGKATLTPSNTPLGRNLSTHQTYPVVADPHSPFAIKQETPEVSSSSSTPSSLSSSAFLD
LQQVGSGVPAGASVPPFNAFPHAASVYGQFTGQALLSGREMVGPTLPGYPPHIPTSGQGS
YASSAIAGMVAGSEYSGSAYGHTPYSSYSEAWRFPNSSLLSSPYYYSSTSRPSAPPTTAT
AFDHL
NT seq 1458 nt   +upstreamnt  +downstreamnt
atggcctgtggccatgagaagccagtggaaggggctcagaagtgggccatctgggatgtc
ctcccagccgtggtggaaaagcacgtgctgggacaagcggccttatgccatggagggctg
aaccagctgggaggggcctttgtgaacggcagacccctgcccgaagtggtgcgtcaacgc
atcgtggacctggcccaccagggggtgaggccctgcgacatctcccgccagctccgagtc
agccatggctgtgtcagcaagatccttggcaggtactacgagaccggaagcatccggcct
ggagtgatagggggctccaagcccaaggtggctacccccaaggtggtggagaagattgga
gactacaagcggcagaaccccaccatgtttgcctgggagatccgagaccggctcctggcg
gagggggtctgtgacaatgacactgtgcccagtgtcagctccatcaacagaatcatccgg
accaaagtgcagcaaccgttcaacctccccatggacagctgcgtggccaccaagtccctg
agcccaggacacacgctgatccccagctcagccgtcacgcccccggagtcaccccagtcg
gactccctgggctccacctactccatcaacgggctcctggggatcgctcagcctggcagc
gacagcaagaggaaaatggacgacagtgaccaggacagctgccggctgagcatcgactcc
cagagcagcagcagcgggccccgcaagcacccgcgcacggactccttcagccagcaccac
cttgagccgctcgagtgcccgttcgagcggcagcactacccagaggcctatgcctccccc
agccacaccaaaggcgagcagggcctctacccgctgcccttgctcaacagtgccgccctg
gacgacggcaaggccaccctgaccccttccaacacgcctttggggcgcaacctctcgact
caccagacctacccagtggtggcagatcctcattcacccttcgccataaagcaggaaacc
cccgaggtgtccagttctagctccaccccttcctctttatctagctccgcctttttggat
ctgcagcaagtcggctccggggtcccagccggtgcctcggtcccgcccttcaatgccttt
ccccatgctgcctccgtgtacgggcagttcacgggccaggccctcctctcagggagagag
atggtgggacccacgctgcccggatacccaccccacatccccaccagcggacagggcagc
tatgcctcttctgccatcgcaggcatggtggcaggaagtgaatactctggcagtgcctac
ggccacaccccctactcctcctacagcgaggcctggcgcttccccaactccagcttgctg
agttccccgtattattacagttccacatcaaggccaagtgcgccacccaccaccgccacg
gcttttgaccacctgtag

DBGET integrated database retrieval system