KEGG   Ursus maritimus (polar bear): 103670355Help
Entry
103670355         CDS       T03271                                 

Gene name
PTGS1
Definition
(RefSeq) prostaglandin-endoperoxide synthase 1
  KO
K00509  prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr00590  Arachidonic acid metabolism
umr01100  Metabolic pathways
umr04611  Platelet activation
umr04726  Serotonergic synapse
umr04923  Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:umr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    103670355 (PTGS1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103670355 (PTGS1)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    103670355 (PTGS1)
  09156 Nervous system
   04726 Serotonergic synapse
    103670355 (PTGS1)
Enzymes [BR:umr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     103670355 (PTGS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF hEGF EGF_2
Motif
Other DBs
NCBI-GeneID: 103670355
NCBI-ProteinID: XP_008697028
UniProt: A0A384CQE2
LinkDB All DBs
Position
Un
AA seq 576 aa AA seqDB search
MSLNPCCYYPCQHQGICVRFGLDRYQCDCTRTGYSGPNCTIPELWTWLRNSLRPSPSFLH
FLLXXXXXXTHGRWFWEFINATFIRDMLMRLVLTARSNLIPSPPTYNIAHDYISWESFSN
VSYYTRVLPSVPQDCPTPMGTKGKKQLPDAQLLGHRFLLRRKFIPDPQGTNLMFAFFAQH
FTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLERQYQLRLFKDGKLKYQVLDGEMYPP
SVEKAPVLMHYPRGVLPRSQMAVGQEVFGLLPGLMLYATLWLREHNRVCDLLKAEHPTWG
DEQLFQTARLILIGETIKIVIEEYVQQLSGYFLRLKFDPELLFSAQFQYRNRIAMEFNQL
YHWHPLMPDSFKVGSQDYSYEQFLFNTSMLVDYGVEALVDAFSRQSAGRIGGGRNIDHHI
LHVAVEAIKESRELRLQPFNEYRKRFGMRPYTSFQELTGEKEIAAELEELYGDIDALEFY
PGLLLEKCHPNSIFGESMIEIGAPFSLKGLLGNPICSPEYWKPSTFGGEMGFNMVKTATL
KKLVCLNTKTCPYVSFHVPDPHQDGGPGVERPSTEL
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgaacccctgttgttactacccatgccagcaccaggggatctgtgtccgcttc
ggccttgaccgctaccagtgtgactgtacccgcacgggctattctggccccaactgcacc
atccctgagctgtggacctggctccggaattcactgcgacccagcccctctttcctccac
ttcctgctgnnnnnnnnnnnnnnnntgacgcacgggcgctggttctgggagttcatcaat
gccaccttcatccgtgacatgctcatgcgtctggtactcacagcgcgttccaaccttatc
cccagcccccccacctacaacatagcgcatgactacatcagctgggagtccttctccaat
gtgagctattacacccgtgttctgccctctgtgccccaagactgccccacgcccatgggg
accaaagggaagaagcagttgccagatgcccagctcctgggccatcgcttcctgctcagg
aggaagttcatacctgacccccaaggcaccaacctcatgttcgccttctttgcacaacac
ttcacccatcagttcttcaaaacttctggcaagatgggtcctggcttcaccaaggccttg
ggccacggggtagatctcggccacatttatggggacaacctggaacgtcagtatcagctg
cggctctttaaggacgggaagctcaagtaccaggtgctggacggagagatgtacccgccg
tcggtggagaaggcgcccgtgttgatgcactatccacggggagttctgccccggagccag
atggccgtgggccaggaggtgtttgggctgcttcccgggctcatgctttatgccacactc
tggctgcgtgagcacaaccgtgtgtgtgacctgctgaaggctgagcaccccacctggggt
gatgagcaactcttccagaccgcccgcctcatcctcatcggggagaccatcaagattgtg
attgaggaatacgtgcaacagttgagcggctacttcctgcggctgaagtttgaccccgag
ctgctgttcagcgcccagttccagtatcgcaaccgtatcgccatggagttcaaccagctc
taccactggcacccgctcatgcccgactccttcaaggtgggctcccaggactacagctac
gagcagttcctgttcaacacctccatgctcgtggactatggggtcgaggccctggtggac
gccttctctcgccagagcgctggccggattggtgggggtagaaacatagaccaccacatc
ctgcacgtggctgtggaggccatcaaggaatcccgtgagctgcggctgcagcccttcaat
gagtaccgcaagaggtttggcatgaggccttacacgtccttccaggagctcacaggggag
aaggagattgcagccgagttggaagagctgtatggagacatcgatgccttggagttctac
ccggggctgcttctggagaagtgccacccaaactccatctttggggagagtatgatagaa
attggggctcccttttccctcaagggcctcctagggaatcccatctgctctccagagtac
tggaagccaagcacattcggtggtgagatgggcttcaatatggtcaagacagccacgctg
aagaagctggtctgcctcaacaccaagacttgcccctacgtttccttccacgtgcccgac
ccccaccaggatggcgggcctggtgtggagcggccatccacagagctctga

DBGET integrated database retrieval system