KEGG   Ursus maritimus (polar bear): 103670397
Entry
103670397         CDS       T03271                                 

Gene name
RALGDS
Definition
(RefSeq) ral guanine nucleotide dissociation stimulator
  KO
K08732  ral guanine nucleotide dissociation stimulator
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04014  Ras signaling pathway
umr04015  Rap1 signaling pathway
umr04072  Phospholipase D signaling pathway
umr05200  Pathways in cancer
umr05210  Colorectal cancer
umr05212  Pancreatic cancer
umr05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    103670397 (RALGDS)
   04015 Rap1 signaling pathway
    103670397 (RALGDS)
   04072 Phospholipase D signaling pathway
    103670397 (RALGDS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103670397 (RALGDS)
   05231 Choline metabolism in cancer
    103670397 (RALGDS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103670397 (RALGDS)
   05212 Pancreatic cancer
    103670397 (RALGDS)
SSDB
Motif
Pfam: RasGEF RasGEF_N RA
Other DBs
NCBI-GeneID: 103670397
NCBI-ProteinID: XP_008697075
UniProt: A0A384CRH5
LinkDB
Position
Un
AA seq 1058 aa
MGLWGTGGDNGAHPKKSWSELELLAQLRKEPHPPGLGWPMAWYKREFLALPIMGADNVQG
LGRSPPSPAQGLHQSAGFAVQELSCGPTAGTPANHPLRGKVPGARKLGPAIPNQRCRLRK
AFPPLASALSLRLLAASGTWRAGLVHTYLVADGVGRRGLGAAFTSPDITPEPLSCRPISS
WLGNLCGRCVSAGDRKAHGALSLQSCTQEIGEELVNGVIYSISLRKVQAHHGTHKGQRWL
GCENESALTLYETCKVRTVKAGTLEKLVEHLVPAFRDSDLSYVTVFLCTYRAFTTTQQVL
DLLFKRYGCILPYSDEDGGPQDQLKNAISSILGTWLDQYSEDFCQPPDFPCLKQLVAYVQ
LNMPGSDLERRAHLLLAQLEHAGPPEAEPEALSPAPAPAPVLKTAPELEPALAPTLLPAP
ELQTPPAPTPEPEAAPAPAPEPEAAPAPTPELEAAPAPTPEPEAAPAPTPELEAAPTPTP
EPEAALAPAPEPKPSLSQTLELEAAPAPGPPWPSPVAAENGLNEKPHLLAFPPDLVAEQF
TLMDAELFKKVVPYHCLGSIWSQRDKKGKEHLAPSVRATVTQFNNVANCVITTCLGDRSV
TARDRARVVEHWIEVARECRVLKNFSSLYAILSALQSNSIHRLKKTWEEVSRDSFRIFQK
LSEIFSDENNYSLSRELLIKEGTSKFATLEMNPKRAQKRPKETGVIQGTVPYLGTFLTDL
VMLDTAMKDYLYGRLINFEKRRKEFEVIAQIKLLQSACNNYSITPEEHFGAWFRAMERLS
EAESYSLSCELEPPSESASNTLKAKKNAAIVKRWSDRQAPSTELSTSGSSHSKSCDQLRC
GPYLSSGDLADALSVHSAGSSSSDVEEINMSFVPESPDGQEKKVTVPLLLPRGPSPAPGP
HPALPARGRDAPAPTQSSPERSVSGVCGCGASLPLYNQQGGDRCITRVSLDVDNGNMYKS
ILVTSQDKAPAVIRKAMDKHNLDEDEPDDYELVQVISEDRKLKIPDNANVFYAMNSTANY
DFVLKKRTFTKGAKVRHGASSTLPRMKQKGLKIAKGIF
NT seq 3177 nt   +upstreamnt  +downstreamnt
atggggctttggggtactggaggagacaacggggcccaccccaagaagagctggtctgag
ctggagctgctggcccagctcaggaaagagccccatccccctggccttggctggcccatg
gcctggtataagcgggaattcctggccctgcccatcatgggagcagataatgtgcagggg
ctgggccgcagtcctccctcgcctgcccagggcctgcaccagtcggcaggcttcgcggtg
caggagctgagctgtgggcccacagcaggaaccccagcaaaccacccgctccgtgggaag
gtgccaggtgcgaggaagctgggccccgccatccccaaccagaggtgtcgcctgaggaag
gccttcccacctctggcctctgctctgagcctcagattgctggcagcttcaggaacctgg
agggctggtcttgttcacacctaccttgtggctgatggggtgggaaggcgagggctgggg
gcagcattcaccagccctgacatcactcccgagcccttgagctgccggcccatttcatcc
tggcttgggaatttgtgtggacgctgtgtctcagctggggaccggaaggctcatggggca
ctgtctctgcagagctgcacgcaggagatcggcgaggagctggtcaacggggtcatctac
tccatctccctgcgaaaggtgcaggcgcaccatggaacccacaagggccagcgctggctt
gggtgtgaaaacgagtccgcgctgacgctgtatgagacctgtaaggtgcggacggtgaaa
gcgggcacgctggagaagctggtggagcacctagtgcccgccttccgggacagcgatctc
tcctacgtcactgtcttcctgtgcacctaccgagccttcacgaccacccagcaggtcctg
gacctgctgttcaaaagatacggatgcatcctcccttattctgacgaggacggcggaccc
caggaccagttgaaaaatgccatctcctccattctgggcacctggctggaccagtactcg
gaggacttctgtcagcccccagactttccctgcctcaagcagctggtggcctacgtgcag
ctcaacatgcctggttctgacctggagcgccgtgcccaccttctgctggcccagctggag
cacgcagggcccccggaggctgagcccgaggctctgtctccagctccagctccagcgcca
gttctaaaaacagctccagaactagagccagctttagcaccaactctcctgcctgcccca
gagctccagacacccccggcacccaccccagagcccgaggcagccccagcacctgctcca
gagcccgaggcagccccagcacccaccccagagcttgaggcagccccggcacccacccca
gagcccgaggcagccccagcacccaccccagagctcgaggcagccccgacacccacccca
gagccagaggcagccctggcacctgctccagagcccaaaccatctctgtcacaaactctc
gagctggaggcagctccagcacccgggcctccctggccttcacctgtggctgcagaaaat
ggcctgaatgagaagcctcacctcttggccttccctcccgacctggtggcagagcagttt
accctgatggatgcggagctgttcaagaaggtggtgccctaccactgcctgggctccatc
tggtcgcagagggacaagaagggcaaggaacacctggctcccagcgtccgggccactgtc
acccagttcaacaacgtggccaactgcgtcatcaccacctgcctgggggaccggagtgtc
acggcccgggacagggccagggtggtggagcactggatcgaagtggccagggagtgccgc
gtcctcaagaacttctcgtcactctacgccatcctgtcagccctacagagcaactccatc
caccggctgaagaagacgtgggaagaagtttccagggacagcttccgaatcttccagaag
ctatcggagatcttctcggatgagaacaactattctctgagcagagagctgctcatcaag
gaggggacctccaagtttgccaccctggagatgaaccccaagagagcccagaaacggcca
aaggagacgggtgtcatccagggcactgttccctacctgggcacgttcctcacagacctg
gtgatgctggacaccgcgatgaaggactatctgtatgggagactgatcaacttcgagaag
aggaggaaggaattcgaagtgattgcccagatcaagctgctacagtcggcatgtaacaac
tacagcatcacgcccgaggagcacttcggggcctggttccgggccatggagcggctgagc
gaggcggagagctacagcctgtcctgtgagctggagcccccctccgagtcggccagcaac
acgctcaaggccaagaagaacgcggccatcgtcaagcgctggagcgaccgccaggccccc
agcacggagctcagtaccagtggcagctcgcactccaagtcctgtgaccagctcaggtgc
ggcccctacctcagcagcggggaccttgccgacgccctcagcgtccactcggccggctcc
tcgagctccgacgtggaggagatcaacatgagctttgtcccggagtcccccgatggtcag
gaaaaaaaggtgactgttccactccttctcccccgaggcccttccccggccccaggcccc
caccccgccctccccgcaaggggccgggacgccccagctcctacccagagctccccggag
cgctccgtgtccggggtctgcggctgcggcgcctcgctgccgctctacaaccagcagggg
ggcgaccgctgcatcacccgcgtcagcctggacgtggacaacggcaacatgtacaagagc
atcctggtaaccagccaagataaggctccagccgtgatccgcaaggccatggacaaacac
aacctggacgaggatgagccagacgactacgagctggtgcaggttatttccgaagatcgg
aagctgaagatccctgacaacgccaacgtgttctatgccatgaactccaccgccaactat
gactttgtcctaaagaaacggaccttcacaaagggggcaaaggtcaggcatggcgccagc
tcaactcttcctcgcatgaagcagaagggactcaagattgccaagggcatcttctga

DBGET integrated database retrieval system