KEGG   Ursus maritimus (polar bear): 103670504
Entry
103670504         CDS       T03271                                 

Gene name
IL3
Definition
(RefSeq) interleukin 3
  KO
K04736  interleukin 3
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04060  Cytokine-cytokine receptor interaction
umr04151  PI3K-Akt signaling pathway
umr04210  Apoptosis
umr04630  JAK-STAT signaling pathway
umr04640  Hematopoietic cell lineage
umr04664  Fc epsilon RI signaling pathway
umr05200  Pathways in cancer
umr05202  Transcriptional misregulation in cancer
umr05221  Acute myeloid leukemia
umr05310  Asthma
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103670504 (IL3)
   04151 PI3K-Akt signaling pathway
    103670504 (IL3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103670504 (IL3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103670504 (IL3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    103670504 (IL3)
   04664 Fc epsilon RI signaling pathway
    103670504 (IL3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103670504 (IL3)
   05202 Transcriptional misregulation in cancer
    103670504 (IL3)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    103670504 (IL3)
  09163 Immune disease
   05310 Asthma
    103670504 (IL3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:umr04052]
    103670504 (IL3)
   00536 Glycosaminoglycan binding proteins [BR:umr00536]
    103670504 (IL3)
Cytokines and growth factors [BR:umr04052]
 Cytokines
  Interleukins
   103670504 (IL3)
Glycosaminoglycan binding proteins [BR:umr00536]
 Heparan sulfate / Haparin
  Cytokines
   103670504 (IL3)
SSDB
Motif
Pfam: IL3
Other DBs
NCBI-GeneID: 103670504
NCBI-ProteinID: XP_008697183
UniProt: A0A384CQV0
LinkDB
Position
Un
AA seq 142 aa
MHSLPILHVLLLLLGLRAPMAQGRSLSTYQPKQYFKMISEIMDILNNSPSPSEETLDPNE
TSTLLNTTLLRPNLDAFLNATKNFYNSESLIWKNLKEFLPLLPTPTPRGQPISIENNLGD
FQKKLKKYLEALDNFLNFKNKQ
NT seq 429 nt   +upstreamnt  +downstreamnt
atgcacagcctccccatcttgcacgttctcctgctcctgcttggactccgagccccaatg
gcacaggggcgctccttgtccacataccagcctaagcaatacttcaagatgatcagtgaa
attatggacatcttaaacaattcaccctcaccttcagaagaaaccttggacccaaatgag
acaagcaccctgctgaacactacccttctgaggccaaacctggatgcattcttgaatgct
accaaaaatttctacaacagtgaatcgctaatctggaaaaatcttaaggaattcctgcca
ctcctgcccactcccacacccagggggcaaccaatctctatcgagaataacttgggtgat
ttccaaaagaagctgaaaaagtatctggaagcccttgacaactttctgaatttcaagaac
aagcaatga

DBGET integrated database retrieval system