KEGG   Ursus maritimus (polar bear): 103670505
Entry
103670505         CDS       T03271                                 

Gene name
CSF2
Definition
(RefSeq) colony stimulating factor 2
  KO
K05427  granulocyte-macrophage colony-stimulating factor
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04060  Cytokine-cytokine receptor interaction
umr04630  JAK-STAT signaling pathway
umr04640  Hematopoietic cell lineage
umr04650  Natural killer cell mediated cytotoxicity
umr04657  IL-17 signaling pathway
umr04660  T cell receptor signaling pathway
umr04664  Fc epsilon RI signaling pathway
umr04668  TNF signaling pathway
umr05146  Amoebiasis
umr05166  Human T-cell leukemia virus 1 infection
umr05167  Kaposi sarcoma-associated herpesvirus infection
umr05171  Coronavirus disease - COVID-19
umr05202  Transcriptional misregulation in cancer
umr05221  Acute myeloid leukemia
umr05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103670505 (CSF2)
   04668 TNF signaling pathway
    103670505 (CSF2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103670505 (CSF2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    103670505 (CSF2)
   04650 Natural killer cell mediated cytotoxicity
    103670505 (CSF2)
   04660 T cell receptor signaling pathway
    103670505 (CSF2)
   04657 IL-17 signaling pathway
    103670505 (CSF2)
   04664 Fc epsilon RI signaling pathway
    103670505 (CSF2)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    103670505 (CSF2)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    103670505 (CSF2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    103670505 (CSF2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103670505 (CSF2)
   05171 Coronavirus disease - COVID-19
    103670505 (CSF2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103670505 (CSF2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103670505 (CSF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:umr03019]
    103670505 (CSF2)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:umr04052]
    103670505 (CSF2)
   00536 Glycosaminoglycan binding proteins [BR:umr00536]
    103670505 (CSF2)
Messenger RNA biogenesis [BR:umr03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Other 3'-5' decay factors
     103670505 (CSF2)
Cytokines and growth factors [BR:umr04052]
 Cytokines
  CSF and other factors
   103670505 (CSF2)
Glycosaminoglycan binding proteins [BR:umr00536]
 Heparan sulfate / Heparin
  Cytokines
   103670505 (CSF2)
SSDB
Motif
Pfam: GM_CSF IL4 FIBP
Other DBs
NCBI-GeneID: 103670505
NCBI-ProteinID: XP_008697184
UniProt: A0A384CRS1
LinkDB
Position
Un
AA seq 277 aa
MWLQNLLFLGTVVYSISAPTSSPSPVTRPSQHVDAIQEALRLLNNSSDDTAVMNKAVKVV
SGMFDRQEPTCLQTRLRLYKEGLPDSLLCLRKPLTLMAKHYEKHCLPTPKCCQAQAQIIL
ELRSSPTMYLYVFLACALWGSENHCASMMTANVSAYDNHTAVCAEIQKELSADNIIYNGS
FKRPQNTSEEPCYGEFTKDFISTLKELTKSNEHDRHIRKVYKDMKELTRICPKLKPTESP
KNCTTEESNFSQFKEALQSVVISIEGWKSCKSIKSSL
NT seq 834 nt   +upstreamnt  +downstreamnt
atgtggctgcagaacctgctttttctgggcactgtggtctacagcatctccgcacccacc
agctcgcccagccctgtcactcgaccctctcagcacgtggatgccatccaagaggccctg
agacttctgaacaatagtagtgatgatactgctgtgatgaataaagcagtaaaagtcgtc
tctggaatgtttgaccgccaggagccgacatgcctgcagacccgcctacggctgtacaag
gagggcctgcctgacagcctcctctgcctcaggaaacccttaaccctgatggccaagcac
tatgagaaacactgcctccctaccccgaaatgctgccaagcccaggctcagatcatcttg
gagctacgctcaagtcctaccatgtacctctacgtgttcctggcttgtgcactctgggga
tcagaaaaccattgcgcctccatgatgacagccaacgtgtctgcctacgacaaccacact
gcagtctgtgctgaaattcagaaagaactctcagctgacaacattatatacaacggttcc
ttcaaaaggccccagaacaccagtgaggagccctgctatggggagtttacgaaggacttc
atctccaccctgaaggaacttacgaaatctaacgagcatgaccgtcacataagaaaggtt
tataaggacatgaaagaactcaccagaatctgcccaaagctgaaaccaacagaatcaccc
aagaactgtactactgaggaaagtaacttctcacagttcaaggaagccttacagagtgtt
gtcatatccatagaaggatggaaatcctgtaaaagcatcaagagcagtctctga

DBGET integrated database retrieval system