KEGG   Ursus maritimus (polar bear): 103671242
Entry
103671242         CDS       T03271                                 

Gene name
MSH6
Definition
(RefSeq) mutS homolog 6
  KO
K08737  DNA mismatch repair protein MSH6
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01524  Platinum drug resistance
umr03430  Mismatch repair
umr05200  Pathways in cancer
umr05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    103671242 (MSH6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103671242 (MSH6)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103671242 (MSH6)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    103671242 (MSH6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:umr03400]
    103671242 (MSH6)
DNA repair and recombination proteins [BR:umr03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Mismatch and loop recognition factors
     103671242 (MSH6)
SSDB
Motif
Pfam: MutS_V MutS_III MutS_I MutS_IV PWWP MutS_II UPF0524
Other DBs
NCBI-GeneID: 103671242
NCBI-ProteinID: XP_008698065
UniProt: A0A384CUA4
LinkDB
Position
Un
AA seq 1260 aa
MEGYPWWPCLVYNHPFDGTFIREKGKSVRVHVQFFDDSPTRGWVSRRLLKPYTGSKSKEV
QKGGHFYSSKPEILRAMQRADEALNKDKIERLKLAVCDEPSEPEEEEEMEVGATYSSDKS
EEDNEVESEEEVQPKVQGSRRSSRQIKKRRVISDSESDIGGSDVEFKPDAKEEGSSDELS
SGVGDSDSEGLDSPVKVASKRKKMVTGNGSLKRKSSRKEMPLATKRSTGISSETKSALNA
FSAPQNSESQAHIGGGCDDSSRPTVWYHETLEWLKEEKRRDLHRRRPDHPDFDASTLYVP
EDFLNSCTPGMRKWWQIKSQNFDLVIFYKVGKFYELYHMDALIGVNELGLVFMKGNWAHS
GFPEIAFGRYSDSLVQKGYKVARVEQTETPEMMEARCRKMAHISKYDRVVRREICRVITK
GTQTYSVLEGDPSENYSKYLLSLKEKEEDSSGHTRVYGVCFVDTSLGKFFIGQFSDDRHC
SRFRTLVAHYPPVQVLFEKGNLSTETKMILKGSLSSSLQEGLIPGSQFWDAAKTLRTLLE
EGYFKEKLNEDSGVMLPQVLKGMTSESDSLGLTPGEKSELALSALGGCIFYLKKCLIDQE
LLSMANFEEYIPLDSDMVSATGPGAFFAKANQRMVLDAVTLNNLEIFMNGTNGSTEGTLL
EKIDTCHTPFGKRLLKQWLCAPLCSPYAINDRLDAIEDLMVVPDKISDVVDLLKKLPDLE
RLLSKIHNVGSPLKSQNHPDSRAIMYEETTYSKKKIIDFLSALEGFKVICKIIEIMEEDV
DNFKSKILKQVVTLQTKTPEGRFPDLTLELNRWDTAFDHEKARKTGLITPKAGFDSDYDQ
ALADIRENEQSLLEYLEKQRSRIGCRTIVYWGIGRNRYQLEIPENFITRNLPEEYELKST
KKGCKRYWTKTIEKKLANLINAEERRDTSLKDCMRRLFYNFDKNYKDWQSAVECIAVLDV
LLCLANYSRGGDGPMCRPVILLPEEGTPPFLDLRGSRHPCIMKTFFGDDFIPNDILIGCE
EEENGKAYCVLVTGPNMGGKSTLMRQAGLLAVMAQTGCYIPAEVCRLTPIDRVFTRLGAS
DRIMSGESTFFVELSETASILTHATAHSLVLVDELGRGTATFDGTAIANAVVKELAENIK
CRTLFSTHYHSLVEDYSQNVAVRLGHMACMVENECEDPSQETITFLYKFIKGACPKSYGF
NAARLANLPEEVIQKGHRKAREFEKMTQSLRLFREVCLASERSTVDAEAVPKLLALIKEL
NT seq 3783 nt   +upstreamnt  +downstreamnt
atggagggttacccctggtggccttgcctggtttacaaccacccttttgatggaacattc
atccgtgagaaagggaagtctgttcgagttcatgtacagttttttgatgacagcccaaca
aggggctgggttagcagaaggctattaaagccatatacaggttcaaaatcaaaggaagtg
caaaaaggaggtcatttttacagttcaaagcctgaaatactcagagcaatgcaacgtgca
gatgaagccttgaataaagacaagattgagaggctaaaattggcagtgtgtgatgagccc
tcagaaccagaggaagaagaagagatggaggtaggtgcaacttactcatcagataagagt
gaagaagataatgaagttgaaagtgaagaggaagtacagcctaaggtccaaggatctagg
cgaagtagccgccaaataaaaaaacgaagggtcatatcagactctgagagtgacattggt
ggctctgatgtggaattcaagccagatgctaaggaggaaggaagtagtgatgaactaagc
agtggggtgggggatagtgacagtgaaggcctggacagtcctgtcaaagttgcttcaaag
cggaagaaaatggtgactggaaatggctctctcaaaaggaaaagttcaaggaaggaaatg
cccttggccaccaaacgatcaactggcatttcgtcagaaaccaagagtgctttgaatgct
ttctctgcccctcaaaattctgaatctcaagcccacattggtggaggatgcgatgatagt
agtcgccccactgtctggtatcatgaaactttagagtggctcaaggaggaaaagaggaga
gatctacacaggaggcgacctgatcaccctgattttgatgcatccacactctatgttcct
gaggatttccttaactcctgtactcctggcatgaggaagtggtggcagattaagtctcag
aactttgatcttgttatattttataaggtggggaagttttatgagctgtaccacatggat
gctcttattggagtcaacgaactaggtctggtattcatgaaaggcaactgggctcattct
ggtttccctgaaattgcatttggccgatattccgattctctggttcagaaaggttataaa
gtagcacgagtggaacagactgagacccctgaaatgatggaggcacgatgccggaagatg
gcacatatatctaagtatgacagagtggtgaggagggagatctgtagagttattaccaag
ggtacacagacctacagtgttttggaaggtgacccctctgagaactacagtaagtatctt
cttagcctcaaagaaaaagaggaggattcttctggccacactcgggtgtatggagtatgc
tttgttgatacctcactgggaaagtttttcataggtcagttttcagatgatcgccattgc
tccagatttaggactctggtggcacactatcctccagtacaagtcctatttgagaaagga
aatctctcaacagaaactaagatgattctgaagggttcactatcctcctctcttcaggaa
ggtctgataccaggctcccagttttgggatgcagccaaaactttgagaactctccttgaa
gaaggatattttaaggaaaagttaaatgaggacagtggggtgatgttaccccaggtgctt
aaaggtatgacctcagagtctgattctcttgggttgacaccaggagagaagagtgaattg
gccctgtctgctctaggtggttgtatcttctacctcaaaaaatgtcttattgatcaagag
cttttatcaatggctaattttgaagaatacattcccttggattctgacatggtcagtgct
acaggacctggtgctttttttgctaaagccaatcaacgaatggtgctagatgctgtgaca
ttaaacaacttagagattttcatgaatggaacaaatggttctactgaagggaccctgcta
gaaaagattgatacttgccatactccctttggtaagcggcttctaaagcagtggctttgt
gccccactctgtagcccttatgctatcaatgatcgtctagatgctatagaagatctcatg
gttgtgcctgacaaaatctctgatgtggtagaccttctaaagaagcttccggaccttgag
aggctgctgagtaaaattcataatgttgggtctcccctgaagagccaaaaccacccagat
agcagggctatcatgtatgaagaaactacatacagcaaaaaaaagattattgattttctt
tctgctctagaaggattcaaagtaatatgtaaaattatagagattatggaagaagacgtt
gacaactttaagtctaaaatccttaagcaggttgttactctacagacaaaaacccctgag
ggccgttttccagatttgactctagagctgaaccgatgggatacagcctttgatcatgaa
aaggctcgaaagactggactaattactcccaaagcaggatttgactctgattatgaccaa
gctcttgctgacataagagaaaatgaacagagcctcctggaatacttggagaaacagcgt
agtcgaataggctgtaggaccattgtctactgggggatcggtaggaaccgttatcagttg
gaaattccagagaattttatcactcgtaatttgccagaagaatatgagttgaaatctacc
aagaagggctgtaagcggtactggaccaaaactattgagaagaagttggctaatctgata
aatgctgaagaacggagagatacatcattgaaggactgcatgcggcgactgttctataac
ttcgataaaaattacaaggactggcagtctgctgttgagtgcatcgcagtattggatgtg
ttattgtgcctggctaactacagtcgagggggtgatggccctatgtgtcgtccagtaatt
ctgttgccagaagaaggcactcctcccttcttagaccttagaggatcacgtcatccctgc
attatgaagactttttttggagatgactttataccaaatgacattctgataggctgtgag
gaagaggaaaatggcaaagcttactgtgtgcttgtcactggacctaacatggggggcaag
tcgacgctcatgagacaggctggcctgttagctgtaatggcccagacgggttgttacata
cctgctgaagtgtgtaggctcacaccaattgatagagtatttactagacttggtgcctca
gacagaataatgtcaggtgaaagtacattttttgtggagttgagtgaaactgccagtata
cttacgcatgcaacagcacattctctggtgcttgtggatgaattaggaagaggtactgca
acatttgatggaacagcaatagcaaatgcggttgttaaagaacttgctgagaacataaag
tgtcgtacactgttttctacccactaccactcattagtagaagattattctcaaaatgtt
gcagttcgcctgggccacatggcatgcatggtagaaaatgaatgtgaggatcccagccag
gagactattaccttcctctataaattcattaagggagcttgtcctaaaagctatggcttt
aatgcagcaaggcttgccaaccttccagaggaggttattcaaaagggacatagaaaagca
agagaatttgaaaagatgactcaatcactgcgattatttcgggaagtttgcctggctagt
gaaaggtcgactgtagatgctgaagctgtccctaaattgctggctttgattaaggaatta
tag

DBGET integrated database retrieval system