KEGG   Ursus maritimus (polar bear): 103672437
Entry
103672437         CDS       T03271                                 

Gene name
CACNA1E
Definition
(RefSeq) calcium voltage-gated channel subunit alpha1 E
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04010  MAPK signaling pathway
umr04020  Calcium signaling pathway
umr04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103672437 (CACNA1E)
   04020 Calcium signaling pathway
    103672437 (CACNA1E)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    103672437 (CACNA1E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:umr04040]
    103672437 (CACNA1E)
Ion channels [BR:umr04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   103672437 (CACNA1E)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel Lustrin_cystein
Other DBs
NCBI-GeneID: 103672437
NCBI-ProteinID: XP_008699352
UniProt: A0A384CWY0
LinkDB
Position
Un
AA seq 2279 aa
MARFGEAVVGRPGSGDGDSDQSRNRXASGPAAAYKQSKAQRARTMALYNPIPVRQNCFTV
NRSLFIFGEDNIVRKYAKKLIDWPPFEYMILATIIANCIVLALEQHLPEDDKTPMSRRLE
KTEPYFIGIFCFEAGIKIVALGFIFHKGSYLRNGWNVMDFIVVLSGILATAGTHFNTHVD
LRTLRAVRVLRPLKLVSGIPSLQIVLKSIMKAMVPLLQIGLLLFFAILMFAIIGLEFYSG
KLHRACFTNNSGILEGFDPPHPCGVQGCPAGYECRDWIGPNDGITQFDNILFAVLTVFQC
ITMEGWTTVLYNTNDALGATWNWLYFIPLIIIGSFFVLNLVLGVLSGEFAKERERVENRR
AFMKLRRQQQIERELNGYRAWIDKAEEVMLAEENKNAGTSALEVLRRATIKRSRTEAMTR
DSSDEHCVDISSVGTPLARASIKSAKVDGASYFRHKERLLRISIRHMVKSQVFYWIVLSL
VALNTACVAIVHHNQPQWLTHLLYYAEFLFLGLFLLEMSLKMYGMGPRLYFHSSFNCFDF
GVTVGSIFEVVWAIFRPGTSFGISVLRALRLLRIFKITKYWASLRNLVVSLMSSMKSIIS
LLFLLFLFIVVFALLGMQLFGGRFNFNDGTPSANFDTFPAAIMTVFQILTGEDWNEVMYN
GIRSQGGVSSGMWSAIYFIVLTLFGNYTLLNVFLAIAVDNLANAQELTKDEQEEEEAFNQ
KHALQKAKEVSPMSAPNMPSIERDRRRRHHMSMWEPRSSHLRERRRRHHMSVWEQRTSQL
RRHMQMSSQEALNKEEAPPMNPLNPLNPLSPLNPLNAHPSLYRRPRPIEGLGLGLGLEKC
EEERISRGGSLKGDGGDLSSALDNQRSPLSLGKREPPWLARPCHGNCDPTQQEAGGGETV
VTFEDRARHRQSQRRSRHRRVRTESKELSSTSRSRSASQERSLDEGVPTEGEKDREPRGS
HAGKEPTIQEEQRGQDLRRTNSLMVPRGSGLAGALDEANTPLVLAQPELEVGKDMALTEQ
EAEGSSEQALLGDVQLDMGRAISQSEPDLSCTTANTDKATTDSTSITVAIPDVGPLVDST
VVHISNKTDGEASPLKEAEIKEEEEEVEKKQQKKEKRETGKAMVPHSSMFIFSTTNPIRR
ACHYIVSLRYFEMCILLVIAASSIALAAEDPVLTNSERNKVLRYFDYVFTGVFTFEMVIK
MIDQGLILQDGSYFRDLWNILDFVVVVGALVAFALANALGTNKGRDIKTIKSLRVLRVLR
PLKTIKRLPKLKAVFDCVVTSLKNVFNILIVYKLFMFXQLFKGKFFYCTDSSKDTEKECI
GNYVDHEKNKMEVKGREWKRHEFHYDNIIWALLTLFTVSTGEGWPQVLQHSVDVTEEDRG
PSRSNRMEMSIFYVVYFVVFPFFFVNIFVALIIITFQEQGDKMMEECSLEKNERACIDFA
ISAKPLTRYMPQNRHTFQYRVWHFVVSPSFEYTIMAMIALNTVVLMMKYYSAPCTYELAL
KYLNIAFTMVFSLECVLKIIAFGFLNYFRDTWNIFDFITVIGSITEIILTDSKLVNTSGF
SRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVFGNIKLDEE
SHINRHNNFRSFFGSLMLLFRSATGEAWQEIMLSCLGEKGCEPDTTAPSGQNENERCGTD
LAYVYFVSFIFFCSFLMLNLFVAVIMDNFEYLTRDSSILGPHHLDEFVRVWAEYDRAACG
RIHYTEMYEMLTLMSPPLGLGKRCPSKVAYKRLVLMNMPVAEDMTVHFTSTLMALIRTAL
DIKIAKGGADRQQLDSELQKETLAIWPHLSQKMLDLLVPMPKASDLTVGKIYAAMMIMDY
YKQSKVKKQRQQLEEQKNAPMFQRMEPSSLPQEIIANAKALPYLQQDPVSGLSGKSAFPS
MSPLSPQEIFQLACMDPADDGQFQEQQSLEPEVSELKSVQSSSHGIYLPSDTQEHTGSGR
ASSMPRLTVDPQVVTDPTSMRRSFSTIRDKRSNSSWLEEFSMERSSENTYKSRRRSYHSS
LRLSAHRLNSDSGHKSDTHRSGGRERGRSKERKHLLSPDVSRCNSEERGTQADWESPERQ
QSRSPSEGRSQTPNQQGTGSLSESSIPSVSDTSTPRRSRRQLPPVPPKPRPLLSYSSLLR
HTGSISPPADGSEGGSPLTSQALESTEPGLVEASSSRHVPQGQHSSPQRYISEPYLALHE
DSHASDCGEEETLTFEAAVATSLGRSNTIGSGRRGGPGPGVMCGAVSDLLSDTEEDDKC
NT seq 6840 nt   +upstreamnt  +downstreamnt
atggctcgcttcggggaggcggtggtcggcaggccagggtcgggcgatggagactcggac
cagagcaggaaccggncggcctcggggccggcggccgcctacaagcagtcgaaagcgcag
agggcgcggactatggctttgtacaaccccattcccgtccggcagaactgtttcaccgtc
aacagatccctgttcatcttcggagaagataacattgtcaggaaatacgccaagaagctc
atcgattggccgccatttgagtacatgattttggccaccatcattgccaactgcattgtc
ttggccctggaacagcatcttcctgaggatgacaagaccccgatgtcccgcagactggag
aagacagaaccgtacttcattgggatcttttgctttgaagctggtatcaaaattgtggcc
ctggggttcatcttccataagggctcgtacctccgcaatggctggaatgtcatggacttc
atcgtagtcctcagtggcatcctggccacggcaggaacccacttcaacacacacgtggac
ctgaggaccctccgggctgtgcgcgtcctgaggcccctgaagctcgtgtcagggatacct
agcctgcagattgtgttgaagtccatcatgaaggccatggtgcctcttctgcaaattggc
cttctgctcttctttgccatcctgatgtttgctatcattggcttggagttctacagtggg
aagttgcaccgcgcgtgtttcacgaacaattcaggtattctggaaggatttgacccccct
cacccatgtggtgtgcagggctgcccagctggttatgaatgccgggactggattggcccc
aatgatgggatcacccagtttgataacatcctttttgctgtgctgaccgtcttccaatgc
atcaccatggaagggtggaccaccgtgctgtacaataccaatgatgccttaggagccacc
tggaactggctgtacttcatccccctcatcatcattggatccttctttgttctcaaccta
gttctgggagtgctctccggggaatttgccaaagagagagagagagtggagaaccggaga
gcattcatgaaactgcggcggcagcagcagattgagcgcgagctgaacgggtaccgcgcc
tggatagacaaagcagaggaagtcatgcttgctgaagaaaataaaaatgccgggacatca
gccttagaagtgcttcgaagggcaaccatcaaaaggagccggacggaggccatgactcga
gactccagtgacgagcactgtgttgatatttcctctgtgggcacacctctcgcccgagcc
agcatcaaaagtgcaaaggtggatggggcctcctatttccggcacaaagaaaggcttctg
cgcatctctatccgccacatggtgaaatcccaggtgttttattggatcgtgttgagcctc
gtggctctcaacaccgcctgtgtggccatcgtccatcacaaccagccccagtggctcacc
catctcctctactatgcagaatttttgtttctgggactgttcctcttggagatgtccctg
aagatgtatggcatggggcctcgactttattttcactcttcattcaactgttttgatttt
ggggtcacagtgggcagtatctttgaagtggtctgggcaatcttcagacctggtacatct
tttggaatcagtgtcttgagagctctccggcttctaagaatatttaaaataaccaagtat
tgggcatctctgcgaaatctggtggtctccttgatgagttctatgaagtctatcatcagt
ttgctcttcctcctcttcctcttcatcgttgtctttgctctcctcggaatgcagctgttt
ggaggcaggtttaactttaatgatgggactccttcagcaaactttgacaccttccctgca
gccatcatgactgtattccagatcctaacaggggaggactggaatgaggtgatgtacaat
gggatccgctcccagggtggggtgagctcaggcatgtggtcagctatctatttcattgtg
ctcaccttgtttggaaactacacactgctgaatgttttcttggccattgctgtggacaat
ctggccaatgcccaagagctgaccaaggatgagcaagaagaagaggaggctttcaaccag
aaacatgcgttgcagaaggccaaggaggtcagcccgatgtctgcacccaacatgccttct
atcgaaagagacagaaggagaagacaccacatgtcgatgtgggagccacgcagcagccac
ctgagggaacggaggcgccggcaccacatgtcggtgtgggagcagcgcaccagccagctg
agaaggcacatgcagatgtccagccaggaggccctcaataaagaggaggccccaccaatg
aaccccctcaaccccctcaacccgctgagtcccctcaacccactcaatgcccaccccagc
ctctaccggagacccaggcccatcgagggcctgggcttgggcctgggcctggagaagtgt
gaggaggaacgcatcagccgtggggggtccctcaagggggatggaggggacctgtcgagt
gccctagacaaccagaggagccccttgtccctgggcaaacgggagccaccgtggctggcc
aggccctgtcatggcaactgtgatccgacccagcaggaggctgggggaggggagaccgtg
gtgaccttcgaggaccgcgccaggcacaggcagagccagcggcgcagccggcaccgtcgt
gtcaggacagaaagcaaggagctctcctccacctcccggagcaggtctgccagccaggag
cggagtctggatgagggggtacccaccgagggggagaaggaccgcgagcccaggggcagc
catgcgggcaaggagcccacaatccaggaagaacagagaggccaagacttaaggaggacc
aacagtctgatggtgcccagaggctccgggctggcaggagcccttgatgaggccaacacg
cccctggtcctggcccagccagagctggaagtggggaaggacatggcactgacggagcag
gaggcggagggcagcagtgagcaggccctgctgggcgacgtgcagttggacatgggcagg
gccatcagccagagtgagcctgacctctcctgcaccacggccaacacagacaaggccacc
accgacagcaccagcatcaccgtcgccatccccgacgtgggccccttggtggactcaact
gtggttcacattagcaacaagactgatggagaagccagtcccttgaaggaggcagagatc
aaagaggaggaggaggaggtggagaagaagcagcagaaaaaggagaagcgtgagacgggc
aaagccatggtgccccacagctccatgttcatcttcagcaccaccaacccgatccgcagg
gcctgccactacatcgtgagcctgcgctactttgagatgtgcattctcctggtgatcgcg
gccagcagcatcgccttggcagccgaggaccccgtcctgaccaactcggagcgcaacaaa
gtcctgaggtattttgactatgttttcactggcgtgttcacctttgagatggttataaag
atgatagaccagggcttgatcctgcaggacgggtcctacttccgagacctgtggaacatc
ctggactttgtggtggttgttggcgcattggtggcctttgctttggcgaacgctttggga
acaaacaaggggcgagacatcaagaccatcaaatctctgcgggtcctccgagttctgagg
ccactgaagaccatcaagcgcttgcccaagctcaaggctgtttttgactgtgtggtgacc
tccttgaagaatgtcttcaacatcctcattgtctacaagctcttcatgttcnntcagctc
ttcaagggaaaattcttttattgcacagacagttccaaagacacagagaaggagtgcata
ggcaactatgtagatcacgaaaaaaacaagatggaggtgaaaggccgggaatggaagcgc
catgaattccactacgacaacattatctgggccctgctgaccctcttcaccgtctccaca
ggggaaggatggcctcaagtcttacagcactctgtcgatgtgacagaggaagaccgagga
ccaagccgcagcaaccgcatggagatgtccatcttttacgtggtctactttgtggtcttc
cctttcttctttgtcaatatctttgtggctctcatcatcatcaccttccaggagcaagga
gacaagatgatggaggagtgtagcctggagaagaatgagagagcgtgcatcgacttcgcc
atcagtgccaaacctctcacccgctacatgccgcagaacaggcacacgttccagtaccgg
gtctggcactttgtggtgtccccgtccttcgagtataccatcatggccatgattgccttg
aacaccgtcgtgctgatgatgaagtactactctgctccctgtacctacgaactggccctg
aagtacctgaatattgccttcaccatggtgttctccctggagtgtgtcctgaagatcatc
gcgtttggcttcttgaactattttcgagacacctggaatatctttgacttcatcaccgtg
attggcagtatcacagaaatcattctgacggacagcaagctggtgaataccagtggcttc
tcccgggccgcccgcctcatcaagcttctacggcagggctacaccatccgaattttactt
tggacctttgtgcagtcctttaaggccctcccctacgtctgccttttgattgccatgctt
ttcttcatctatgccatcattgggatgcaggtatttggaaacataaaattagatgaggag
agtcacatcaaccggcacaacaacttccggagtttctttgggtccctcatgttactcttc
aggagtgccacaggtgaggcctggcaggagataatgctgtcgtgccttggggagaaaggc
tgcgaacccgacaccaccgcgccttcagggcagaacgagaatgagcgctgtggcacagac
ctggcctacgtttactttgtctccttcatcttcttctgctctttcttgatgctcaacctg
ttcgtggccgtcatcatggacaactttgagtacctgactcgggactcctccatcttaggg
cctcaccacttggacgagtttgtccgcgtctgggcggaatatgacagagctgcatgtggc
cgcatccattacactgagatgtatgaaatgctgactctcatgtcaccaccgctaggcctc
ggcaagagatgtccctccaaagtggcatataagaggttggtcctgatgaatatgccagta
gccgaggacatgaccgtccacttcacctccacacttatggctctgatccggacagctctg
gacatcaaaatcgccaaaggtggtgcagacaggcagcagctagactcggagctgcaaaag
gagaccctggccatttggccccacctgtcccagaagatgctagatctgcttgtgcccatg
cccaaagcctctgacctgactgtgggcaaaatctatgcagcaatgatgatcatggactac
tataaacagagtaaggtgaagaagcagaggcagcagctggaggaacagaaaaatgcaccc
atgttccagcgcatggagccctcatctctgcctcaggagatcattgctaatgccaaagcc
ctgccctatctccagcaggaccctgtttcaggcctcagtggaaagtctgcttttccttcg
atgagtccgctctccccccaggaaatattccagttggcttgtatggacccagccgatgat
ggacagttccaggaacagcagtctctggagccagaggttagtgaattaaaaagcgtgcag
tcctctagccatggcatctaccttccttcggacacccaggagcatacgggatctgggagg
gcatcctctatgccacgcctgactgtggatccccaggtggtgacagatcctacctccatg
agacgttcattttccacgattcgggataagcgttcaaattcctcatggttggaggaattc
tccatggagagaagtagcgaaaacacctacaagtcacgtcgccggagttaccactcctcg
ctgagactgtcagctcatcgcctgaattctgactcaggccacaagtctgacacccaccgc
tcagggggcagagagcggggacggtcaaaagagcgaaagcatcttctctctcccgacgtc
tcccgctgcaactcagaggagcgagggactcaggccgactgggagtccccggagcgccag
cagtccaggtctcccagtgagggcaggtcgcagacccccaaccaacagggcacaggctcc
ctgagtgaaagctccatcccctccgtctctgacaccagcaccccaagacgaagtcgccgg
cagctcccccctgttccaccaaagcctcggcccctcctttcctacagctccctgctgcgc
cacaccggaagcatctctcccccagctgatggaagcgagggtggctccccgctgacctcc
caggcgctggagagcacagagcctggcctggtggaggcttccagctcccggcatgtcccg
cagggccagcactcctccccacagcgctacatctccgagccctacctggccctgcacgaa
gactcccacgcctcagactgtggcgaggaggagacgctcaccttcgaagccgccgtggcc
accagcctgggccgctccaacaccatcggctcagggcggcgcgggggaccagggccaggt
gtgatgtgtggggctgtcagcgacctcctgagtgacacggaagaagacgacaagtgctag

DBGET integrated database retrieval system