KEGG   Ursus maritimus (polar bear): 103672737
Entry
103672737         CDS       T03271                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01521  EGFR tyrosine kinase inhibitor resistance
umr04010  MAPK signaling pathway
umr04014  Ras signaling pathway
umr04015  Rap1 signaling pathway
umr04020  Calcium signaling pathway
umr04072  Phospholipase D signaling pathway
umr04144  Endocytosis
umr04151  PI3K-Akt signaling pathway
umr04510  Focal adhesion
umr04540  Gap junction
umr04630  JAK-STAT signaling pathway
umr04810  Regulation of actin cytoskeleton
umr05163  Human cytomegalovirus infection
umr05200  Pathways in cancer
umr05206  MicroRNAs in cancer
umr05214  Glioma
umr05215  Prostate cancer
umr05218  Melanoma
umr05230  Central carbon metabolism in cancer
umr05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103672737 (PDGFRA)
   04014 Ras signaling pathway
    103672737 (PDGFRA)
   04015 Rap1 signaling pathway
    103672737 (PDGFRA)
   04630 JAK-STAT signaling pathway
    103672737 (PDGFRA)
   04020 Calcium signaling pathway
    103672737 (PDGFRA)
   04072 Phospholipase D signaling pathway
    103672737 (PDGFRA)
   04151 PI3K-Akt signaling pathway
    103672737 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103672737 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103672737 (PDGFRA)
   04540 Gap junction
    103672737 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103672737 (PDGFRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103672737 (PDGFRA)
   05206 MicroRNAs in cancer
    103672737 (PDGFRA)
   05230 Central carbon metabolism in cancer
    103672737 (PDGFRA)
   05231 Choline metabolism in cancer
    103672737 (PDGFRA)
  09162 Cancer: specific types
   05214 Glioma
    103672737 (PDGFRA)
   05218 Melanoma
    103672737 (PDGFRA)
   05215 Prostate cancer
    103672737 (PDGFRA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    103672737 (PDGFRA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103672737 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:umr01001]
    103672737 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:umr04090]
    103672737 (PDGFRA)
Enzymes [BR:umr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     103672737 (PDGFRA)
Protein kinases [BR:umr01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   103672737 (PDGFRA)
CD molecules [BR:umr04090]
 Proteins
  103672737 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 Herpes_gE V-set Kinase-like
Other DBs
NCBI-GeneID: 103672737
NCBI-ProteinID: XP_008699701
UniProt: A0A384CY35
LinkDB
Position
Un
AA seq 1098 aa
MACEQFSGTMGTSLLAFLILGSLLTGPSRVFCQLSLPSILPNENEKVVQLNSSFSLRCFG
ESEVSWQYPMSEEENPNVEIRNEENNSGLFVAVLEVVSAAAAHTGLYTCYYNHTQTEETD
IEGRRIYIYVPDPDVAFVPLGMTDYLVIVEDDDSAIIPCRTTDPETPVTLRSNDGVVHAS
YDSRQGFNGTFSVGPYICEATVRGKKFQTIPFNVYALKATSELDLEMEALKTVYKSGETI
VVTCAVFNNEVVDLQWTYPGEVKGKGITMLEEIKVPSIKLVYTLRVPEATVKDSGDYECA
ARQATKEVKEMKKVTISVHEKGFIEIKPNFSPLEAVDLHEVKHFVVDVQAYPPPRISWLK
DNLTLIENLTEITTDIEKIQEIRYRSKLKLIRAKEEDSGHYTIVVQNEDDVKSYTFELLT
QVPSSILDLVDDHHGSTGGQTVRCTAEGTPLPDIEWMICKDIKKCNNETSWAILANNISN
IITEVHPRDRSTVEGRVTFTRVEETIAVRCLAKNLLGAESRELKLVAPTLRSELTVAAAV
LVLLVIVIISLIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRD
GLVLGRILGSGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHL
GPHLNIVNLLGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFLSRHPEKPKKELDIFGLN
PADDSTRSYVILSFENNGDYMDMKQADATQYVPMLERKEAAKYSDIQRSLYDRPASSKKK
SVLDSEVKNLLSDDNSEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKI
VKICDFGLARDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSL
GGTPYPGMMVDSTFYNKIKSGYRMAKPDHATSEVYEIMVKCWHSEPEKRPSFYHLSEIVE
NLLPGQYKKSYEKIHLDFLKSDHPAVARMRVDADNAYIGVTYKNEEDKLKDWEGSLDEQR
LSADSGYIIPLPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDID
MMDDIGIDSSDLVEDSFL
NT seq 3297 nt   +upstreamnt  +downstreamnt
atggcctgcgagcagttttccggaacgatggggacttcccttctggccttcctgatctta
ggctctctcctcacagggcccagccgagtcttctgccagctttcattaccctccatcctg
ccaaacgaaaatgaaaaggtcgtgcagctgaattcatccttttctctgagatgctttggg
gagagtgaagtgagctggcagtaccccatgtctgaagaagagaaccccaatgtggaaatc
agaaacgaggagaacaacagcggcctttttgtggccgtgctggaggtggtcagcgcggcg
gcggcgcacacgggcttgtacacctgctattacaaccacacccagacggaggagaccgac
atcgagggcaggcgtatctacatctacgtgccagacccggatgtagccttcgtgcctctg
ggaatgacagattatttagtcatcgtggaggatgatgattctgccatcataccttgtcgc
acgactgatcctgagactccggtcaccttgcgcagcaatgacggggtggtgcacgcctcc
tatgacagcagacagggcttcaatgggaccttcagcgttgggccctatatctgtgaagcc
accgtcaggggaaagaagttccagaccatcccatttaatgtttatgctttaaaagcaacg
tcagaacttgatctagaaatggaagctcttaaaactgtgtataagtcaggggagacgatt
gtggtcacctgcgccgtctttaacaacgaggtggtcgaccttcagtggacttaccctgga
gaagtgaaaggcaaaggcatcaccatgctggaggaaatcaaggtcccgtccatcaaattg
gtgtatactctgagggtccccgaggccacggtgaaagatagtggagattatgaatgtgct
gcccgccaggccaccaaggaggtcaaagagatgaagaaagtcaccatttctgtccatgag
aaagggttcattgaaatcaaacccaacttcagcccgttggaagctgtcgacctgcatgaa
gtcaaacatttcgtggtggacgtgcaggcctacccccctcccaggatatcctggctgaag
gacaacctgactctgattgaaaatctcacggagatcaccacggacatagaaaagattcag
gaaataaggtatcggagcaaattaaagctgatccgtgctaaggaggaagacagtggccat
tacacgatcgtcgttcaaaatgaagatgacgtgaagagctatactttcgaactcctaact
caagttccctcatctattctggacttggtggacgaccaccacggctccacggggggacag
accgtgagatgcaccgccgaagggacgcctcttcctgatatcgagtggatgatttgcaag
gatattaagaagtgtaataatgaaacttcatgggcgattttggccaacaatatctcaaac
atcatcacggaggtccacccccgagacaggagcactgtggagggccgagtgacgttcacc
agagtggaggagaccatcgccgttcgatgtctggccaagaatctccttggggccgagagc
cgcgagctcaagctggtggctcccacgctgcgctctgagctcacggtggctgctgccgtc
ctcgtgctgctggtgattgtcatcatctccctcatcgtcctggtcgtcatttggaaacag
aaaccgaggtatgaaattcgctggagggtcattgaatccatcagcccggatggacatgaa
tatatttatgtggacccgatgcagctgccttatgactcgagatgggagtttccaagagat
ggactagtgcttggtcgtatcctgggatctggcgcgtttgggaaagtggttgaaggaact
gcctatggattaagccgctcccagcctgtcatgaaggtagcagtgaagatgctgaaaccc
acagccagatccagtgagaaacaggctcttatgtcggaactgaagataatgactcacctg
gggccgcatttaaacattgtgaacttgctgggagcctgtaccaagtcaggccctatttac
atcatcactgagtactgcttctatggggatttggtcaactatttgcataagaatagggat
agcttcctgagccgccacccggagaagccaaagaaagagctggacatttttggattgaac
cctgccgacgacagcacacggagttacgtcattttatcttttgaaaacaacggtgactac
atggacatgaagcaagctgacgccacccagtacgtccccatgctggaaaggaaagaggct
gccaagtactcagacatccagagatcgctgtatgatcgcccggcctcgtctaagaagaag
tctgtgttagactcagaagtcaaaaacctcctttcggatgataactcagaaggccttact
ttgttggatttgttgagctttacctatcaagttgcacgaggaatggaatttttggcttcg
aaaaattgtgtccaccgggacctggctgctcgaaacgtcctcctggcgcaagggaaaatc
gtgaagatctgtgacttcggcctggccagagacatcatgcacgattcgaactacgtgtcg
aaaggcagtacctttctccctgtgaagtggatggcccctgagagcatcttcgacaacctc
tacaccacactgagtgacgtctggtcttacggcattctgctctgggagatcttttccctc
ggcggcacaccctaccccggcatgatggtggattctactttctacaataagattaagagt
gggtaccggatggccaagcctgaccacgccaccagtgaagtctacgagatcatggtgaaa
tgctggcacagtgagccggagaagagaccctccttctaccacctgagtgagattgtggag
aacctgctgcccggacagtataagaagagttacgaaaagattcacctggacttcctgaag
agcgaccaccccgccgtggcgcgcatgcgcgtggacgccgacaacgcctacattggcgtc
acctacaaaaacgaggaagacaagctgaaggactgggagggcagcctggacgagcagagg
ctgagcgcggacagcggctacatcatccccctgcccgacatcgaccctgtccctgaggag
gaagacctgggcaagaggaacagacacagctcgcagacctcagaagagagtgctatcgag
acaggttcgagcagctccaccttcatcaagagagaggacgagaccatcgaggacatcgac
atgatggacgacattggcatagactcctcagacctggtagaggacagcttcctgtga

DBGET integrated database retrieval system