KEGG   Ursus maritimus (polar bear): 103674257
Entry
103674257         CDS       T03271                                 

Gene name
GXYLT2
Definition
(RefSeq) glucoside xylosyltransferase 2
  KO
K13676  UDP-xylose:glucoside alpha-1,3-xylosyltransferase [EC:2.4.2.-]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr00514  Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:umr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    103674257 (GXYLT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:umr01003]
    103674257 (GXYLT2)
Enzymes [BR:umr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.-  
     103674257 (GXYLT2)
Glycosyltransferases [BR:umr01003]
 Glycan extension
  O-Glycan
   103674257 (GXYLT2)
SSDB
Motif
Pfam: Glyco_transf_8
Other DBs
NCBI-GeneID: 103674257
NCBI-ProteinID: XP_008701366
UniProt: A0A384D2Z8
LinkDB
Position
Un
AA seq 317 aa
MLKSAVLFSHRKIQFHIFTEDSLKPEFDKQLRQWPDSYTKKFEHRIYPITFSVGNPQEWK
KLFKPCAAQRLFLPVILKDVDSLLYVDTDVLFLRPVDDIWKLLRQFNATQLAAMAPEHEI
PKIGWYSRFARHPFYGSAGVNSGVMLMNLTRIRSAQFKNSMIPTGLAWEDMLYPLYQKYK
NAITWGDQDLLNIIFYFNPECLYVFPCQWNYRPDHCMYGSNCKAAEREGVSVLHGNRGVY
HDDKQPTFKALYEAIRDFPFQDNLFQSMYYPLQLKFLETVHTLCGRIPQVFLKQIEKTMK
RAYEKHVIIHVGPNQMH
NT seq 954 nt   +upstreamnt  +downstreamnt
atgctcaagtccgctgtgctctttagccacaggaagatccaattccacatcttcacggag
gactctctgaagcccgagtttgataagcagttacgacagtggcctgactcatatacaaag
aagtttgagcacagaatctaccccatcacattttcggttggaaaccctcaggaatggaag
aaattattcaaaccctgtgctgctcagagactctttcttccggtgattttaaaggatgtg
gattcgcttctctacgtggacaccgacgttctctttctgagacccgttgatgacatctgg
aagcttctgaggcagtttaatgccacgcagcttgctgccatggcccctgagcatgaaatc
cccaagattggctggtacagtcgctttgctcggcaccctttctatggctctgcaggagtt
aattcaggagtcatgctgatgaatctaactcgcataagaagtgcccagtttaagaacagc
atgattccaacaggcttggcttgggaggacatgttgtaccctctgtaccagaagtacaag
aatgccatcacgtggggagaccaggatttattaaatattattttttatttcaatccagag
tgtctctatgtgttcccctgccagtggaactaccgccccgaccactgcatgtacggaagc
aactgcaaagccgctgagcgggaaggcgtgtctgtgctgcacgggaaccgaggcgtctac
catgatgataagcagcccactttcaaagcgctctatgaagcaatacgggattttcccttt
caagacaatctctttcaatccatgtattacccgctccagctgaagtttctggagactgtg
cacactttatgtggacgaatcccacaagtgtttttgaagcaaatcgagaaaacaatgaaa
agggcttatgagaaacacgtcatcatccatgtgggccccaaccagatgcactga

KEGG   Ursus maritimus (polar bear): 103675585
Entry
103675585         CDS       T03271                                 

Gene name
GXYLT1
Definition
(RefSeq) glucoside xylosyltransferase 1
  KO
K13676  UDP-xylose:glucoside alpha-1,3-xylosyltransferase [EC:2.4.2.-]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr00514  Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:umr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    103675585 (GXYLT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:umr01003]
    103675585 (GXYLT1)
Enzymes [BR:umr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.-  
     103675585 (GXYLT1)
Glycosyltransferases [BR:umr01003]
 Glycan extension
  O-Glycan
   103675585 (GXYLT1)
SSDB
Motif
Pfam: Glyco_transf_8
Other DBs
NCBI-GeneID: 103675585
NCBI-ProteinID: XP_008702933
UniProt: A0A384D787
LinkDB
Position
Un
AA seq 450 aa
MLVGRQDMHTQQHYELSPTPRSFRHTPPLHCGATGVTCPEFLWRSPQTPRTPILSRSLRL
RLQQLPALRGGAHGGGGGVRAPGGCKDFSLCYWNPYWMLPSDVCGMNCFWEAAFRYSLNV
QPIQRMHLAVVACGERLEETVTMLKSAIIFSIRPLQFHIFAEDQLHDSFKGILDGWSFLQ
TFNYSLYPITFPSENAAEWKKLFKPCASQRLFLPLILKEVDSLLYVDTDILFLRPVDDIW
SLLKKFNSTQIAAMAPEHEEPRIGWYNRFARHPYYGKTGVNSGVMLMNMTRMRRKYFKND
MTTVRLRWGDILMPLLKKYKLNITWGDQDLLNIIFFHNPESLFVFPCQWNYRPDHCIYGS
NCQEAEEEGIFILHGNRGVYHDDKQPAFRAIYEALRNCSFKDDNIRSLLKPLELELQKTV
HTYCGKIYKIFIKQLTKSIQDRYDRPPKER
NT seq 1353 nt   +upstreamnt  +downstreamnt
atgctcgttgggaggcaagatatgcatactcaacagcattacgagctgtctccaacgccg
cgttcatttcgccacacccctcctctgcactgcggagccactggagttacctgccccgag
ttcctttggcgttcccctcagaccccccgcacgccgattctctcgcgctccctgcgcctg
cgcctccagcagctgcccgcactccggggaggggcccacggcggcggaggcggtgtcagg
gccccgggcgggtgtaaagatttctctctgtgttactggaatccctattggatgctgccc
tctgatgtttgtggaatgaactgcttttgggaagcggcttttaggtatagtctgaatgtg
cagcccattcagagaatgcacctcgctgtggttgcctgtggtgaaagactggaagaaact
gtaaccatgttgaagtcagctatcattttcagcatcagacctcttcagttccatattttt
gctgaagatcaattacacgacagttttaaaggcatacttgatggctggtcatttctgcag
acatttaattattcattatacccaataacttttccaagtgaaaatgcagcggagtggaaa
aagctttttaaaccatgtgcttcccagagattattcttgccattaatcctgaaagaagtt
gactcattattgtacgtcgacactgacatcctttttttacggcctgttgatgatatttgg
tctttactaaagaaatttaattccacacaaattgctgcaatggcaccagaacatgaagag
cctcgaataggctggtataatcgctttgccagacatccatattatggaaaaactggagta
aactctggagttatgttgatgaacatgactagaatgagaaggaagtatttcaagaatgac
atgacaactgtacggctgcgatggggagatatacttatgccattgcttaaaaaatacaaa
cttaacatcacatggggggatcaagatctgttgaatatcatcttttttcataatccagaa
agcctttttgtttttccgtgtcaatggaattatcgaccagatcattgtatatatggaagc
aattgccaggaagcagaagaagaaggaatctttattcttcatgggaacagaggtgtttac
catgatgataagcaaccagcatttagagccatttatgaagcactgagaaattgttctttt
aaagatgacaacatccgttccttattaaaacctttagaactggaactacaaaagacagtc
catacgtactgtggaaaaatttacaaaatatttatcaaacagctaacaaaaagcatacaa
gatcgttatgatagaccaccaaaggaaaggtga

DBGET integrated database retrieval system