KEGG   Ursus maritimus (polar bear): 103675694
Entry
103675694         CDS       T03271                                 

Gene name
BID
Definition
(RefSeq) BH3 interacting domain death agonist
  KO
K04726  BH3 interacting domain death agonist
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01524  Platinum drug resistance
umr04071  Sphingolipid signaling pathway
umr04115  p53 signaling pathway
umr04210  Apoptosis
umr04215  Apoptosis - multiple species
umr04217  Necroptosis
umr04650  Natural killer cell mediated cytotoxicity
umr04932  Non-alcoholic fatty liver disease
umr05010  Alzheimer disease
umr05014  Amyotrophic lateral sclerosis
umr05022  Pathways of neurodegeneration - multiple diseases
umr05152  Tuberculosis
umr05160  Hepatitis C
umr05161  Hepatitis B
umr05162  Measles
umr05163  Human cytomegalovirus infection
umr05164  Influenza A
umr05167  Kaposi sarcoma-associated herpesvirus infection
umr05168  Herpes simplex virus 1 infection
umr05169  Epstein-Barr virus infection
umr05170  Human immunodeficiency virus 1 infection
umr05200  Pathways in cancer
umr05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    103675694 (BID)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103675694 (BID)
   04215 Apoptosis - multiple species
    103675694 (BID)
   04217 Necroptosis
    103675694 (BID)
   04115 p53 signaling pathway
    103675694 (BID)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    103675694 (BID)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103675694 (BID)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103675694 (BID)
   05014 Amyotrophic lateral sclerosis
    103675694 (BID)
   05022 Pathways of neurodegeneration - multiple diseases
    103675694 (BID)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    103675694 (BID)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    103675694 (BID)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    103675694 (BID)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103675694 (BID)
   05161 Hepatitis B
    103675694 (BID)
   05160 Hepatitis C
    103675694 (BID)
   05164 Influenza A
    103675694 (BID)
   05162 Measles
    103675694 (BID)
   05168 Herpes simplex virus 1 infection
    103675694 (BID)
   05163 Human cytomegalovirus infection
    103675694 (BID)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103675694 (BID)
   05169 Epstein-Barr virus infection
    103675694 (BID)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    103675694 (BID)
SSDB
Motif
Pfam: BID Bcl-2
Other DBs
NCBI-GeneID: 103675694
NCBI-ProteinID: XP_008703032
UniProt: A0A384D7H6
LinkDB
Position
Un
AA seq 195 aa
MDCKVSNGPGLQDEHITNLLVFGFLQNCSNSNFHKELEVLGREVSMPAYLPEDYDDGLQT
DGNRCSYFLESGERDSQGQEEIIQDIARQLAQIGDDMDHSIHPGLMNNLAMQFMNVNLSE
EDRRKSLAAALEQVMQTYPMDMEEEKTMLILAMLLAKKVADHTPSLLRDVFRTTVNFINQ
NLFTYVRNLVRNEMD
NT seq 588 nt   +upstreamnt  +downstreamnt
atggattgtaaggtcagcaatggtccaggcctccaggatgaacacatcacaaacctgctg
gtgtttggcttcctccaaaactgctccaactctaatttccacaaagagttggaggtgctg
ggccgtgaagtgtccatgccagcttacctgccggaggactacgacgacgggctgcagaca
gacggcaaccggtgcagctacttcctggaaagtggggagagagattctcagggtcaagaa
gaaatcatccaggatatcgccaggcagctcgcccaaataggggacgatatggatcacagc
atccacccaggactcatgaataacctggcaatgcagtttatgaatgtgaacctgtcggaa
gaagacagaaggaagtccctcgccgctgcgctggagcaggtcatgcagacttaccctatg
gacatggaggaggagaagaccatgctgatattggccatgctcttggccaaaaaggtggct
gatcacacaccatccttgctccgtgatgtctttcgcacaacagtgaactttattaaccag
aatttgttcacctacgtgaggaacttagtcagaaatgagatggactga

DBGET integrated database retrieval system