KEGG   Ursus maritimus (polar bear): 103675797
Entry
103675797         CDS       T03271                                 

Gene name
APC
Definition
(RefSeq) APC, WNT signaling pathway regulator
  KO
K02085  adenomatosis polyposis coli protein
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04310  Wnt signaling pathway
umr04390  Hippo signaling pathway
umr04550  Signaling pathways regulating pluripotency of stem cells
umr04810  Regulation of actin cytoskeleton
umr04934  Cushing syndrome
umr05010  Alzheimer disease
umr05022  Pathways of neurodegeneration - multiple diseases
umr05165  Human papillomavirus infection
umr05200  Pathways in cancer
umr05206  MicroRNAs in cancer
umr05210  Colorectal cancer
umr05213  Endometrial cancer
umr05217  Basal cell carcinoma
umr05224  Breast cancer
umr05225  Hepatocellular carcinoma
umr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103675797 (APC)
   04390 Hippo signaling pathway
    103675797 (APC)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103675797 (APC)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103675797 (APC)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103675797 (APC)
   05206 MicroRNAs in cancer
    103675797 (APC)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103675797 (APC)
   05225 Hepatocellular carcinoma
    103675797 (APC)
   05226 Gastric cancer
    103675797 (APC)
   05217 Basal cell carcinoma
    103675797 (APC)
   05213 Endometrial cancer
    103675797 (APC)
   05224 Breast cancer
    103675797 (APC)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103675797 (APC)
   05022 Pathways of neurodegeneration - multiple diseases
    103675797 (APC)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103675797 (APC)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103675797 (APC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:umr01009]
    103675797 (APC)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:umr03036]
    103675797 (APC)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:umr04812]
    103675797 (APC)
Protein phosphatases and associated proteins [BR:umr01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     103675797 (APC)
Chromosome and associated proteins [BR:umr03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    103675797 (APC)
Cytoskeleton proteins [BR:umr04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    EB / APC
     103675797 (APC)
SSDB
Motif
Pfam: Arm_APC_u3 APC_basic EB1_binding APC_r APC_u14 APC_rep APC_u5 APC_u15 APC_u9 SAMP APC_N_CC Arm APC_u13 APC_15aa Suppressor_APC JIP_LZII
Other DBs
NCBI-GeneID: 103675797
NCBI-ProteinID: XP_008703157
UniProt: A0A384D7V3
LinkDB
Position
Un
AA seq 2821 aa
MAAASYDQLLKQVEALKMENSNLRQELEDNSNHLTKLETEASNMKEVLKQLQGSIEDEAM
ASSGQIDLLERLKELNLDSSNFPGVKLRSKMSLRSYGSREGSVSSRSGECSPVPMGSFPR
RGFVNGSRENTGYLEELEKERSLLLADLDKEEKEKDWYYAQLQNLTKRIDSLPLTENFSL
QTDMTRRQLEYEARQIRVAMEEQLGTCQDMEKRAQRRVTRIQQIEKDILRIRQLLQSQAT
EAERSSQSKHEAGSHEAERQSEGQGVAEINMATSGGGQGSTTRMDHETASVLSSSSTHSA
PRRLTSHLGTKVEMVYSLLSMLGTHDKDDMSRTLLAMSSSQDSCISMRQSGCLPLLIQLL
HGNDKDSVLLGNSRGSKEARARASAALHNIIHSQPDDKRGRREIRVLHLLEQIRAYCETC
WEWQEAHEQGMDQDKNPMPAPVEHQICPAVCVLMKLSFDEEHRHAMNELGGLQAIAELLQ
VDCEMYGLTNDHYSITLRRYAGMALTNLTFGDVANKATLCSMKGCMRALVAQLKSESEDL
QQVIASVLRNLSWRADVNSKKTLREVGSVKALMECALEVKKESTLKSVLSALWNLSAHCT
ENKADICAVDGALAFLVGTLTYRSQTNTLAIIESGGGILRNVSSLIATNEDHRQILRENN
CLQTLLQHLKSHSLTIVSNACGTLWNLSARNPKDQEALWDMGAVSMLKNLIHSKHKMIAM
GSAAALRNLMANRPAKYKDANIMSPGSSLPSLHVRKQKALEAELDAQHLSETFDNIDNLS
PKASHRNKQRHKQSLYSDYVFDTNRHDDNRSDNFNAGNMTVLSPYLNTTVLPSSSSSRGS
LDSSRSEKDRSLERERGISLGNYHPATENPGPSSKRGLQISTTAAQIAKVMEEVSAIHTS
QEDRSSGSTTELHCGTDERNALRRSSTAHTHANTYNFSKSENSNRTCPMPYAKLEYKRSS
NDSLNSVSSSDGYGKRGQMKPSIESYSEDDESKFCSYGQYPADLAHKIHSANHMDDNDGE
LDTPINYSLKYSDEQLNSGRQSPSQNERWARPKHVIEDEIKQSEQRQSRSQSTTYPVYTE
STDDKHXVSPYRSRGANGSETNRVGSNHGINQNVNQSLCQEDDYEDDKPTNYSERYSEEE
QREEEERPTNYSIKYNEDKHHVDQPIDYSLKYATDIASSQKPPFSFSKNSSGQSTKTEHL
PSSSENTSTPSSNGKRQNQHHPSSAQSRTGQTPKATSCKVPSINQETIQTYCVEDTPICF
SRCSSLSSLSSAEDEIGCDQATQETDSANTLQIAEIKENSGTRTTEDSVSEVPTVSQHIR
TKSSRLQASGLSAESTRHKAVEFSSGAKSPSKSGAQTPKSPPEQYVQETPLMFSRCTSVS
SLDSFESRSIASSVQSEPCSGMVSGIISPSDLPDSPGQTMPPSRSKTPPPPPQTVQTKRE
VPKNKAPTAEKRESGPKQAAVNAAVQRVQVLPDADTLLHFATESTPDGFSCSSSLSALSL
DEPFIQKDVELRIMPPVQENDNGNETESEQPEEANENQEKETEKPTDSEKDLLDDSDDDD
IEILEECIISAMPTKSSRKAKKPAQTASKLPPPVARKPSQLPVYKLLPSQNRLQAQKHVS
FTPGDDMPRVYCVEGTPINFSTATSLSDLTIESPPNEFAAGEGVRTAAQSSEFEKRDTIP
TEGRSTDEAQRGKTPSVTIPEPDDSKTEEGDILAECINSAMPKGKSHKPFRVKKIMDQVQ
QASMSSSGANKNQLDGKKKKPTSPVKPMPQNTEYRTRVRKNTDSKNNLNAERTFSDNKDS
KKQNLKNNAKDFNDKLPNNEDRVRGSFTFDSPHHYTPIEGTPYCFSRNDSLSSLDFDDDD
VDLSREKAELRKGKENKESEAKVTSHTELTSNQQSANKTQAVTNHPVNRGQSKPTLQKQS
TFPQSSKGAPDRGAATDEKLQNFALENTPVCFSRNSSLSSLSDIDQENNNNKENEPVKET
EPPDSQGEPSKPQASGYAPKSFHVEDTPVCFSRNSSLSSLSIDSEDDLLQECISSAMPKK
KKPSRLKGDNEKHSPRNMSGILAEDLTLDLKDIQRPDSEHGLSPDSENFDWKAIQEGANS
IVSSLHQAAAAACLSRQASSDSDSILSLKSGISLGSPFHLTPDQEEKPFTSNKGPRILKP
GEKSTLETKKIESENKGIKGGKKVYRSLITGKIRSHSEVSSQMKQPLQANMPSISRGRTM
IHIPGVRNSSSSTSPVSKKGPPLKTPASKSPSEGQTATTSPRGAKPSVKSELSPVTRQTS
QPAGANKGPSRSGSRDSTPSRPAQQPLSRPMQSPGRNSISPGRNGISPPNKLSQLPRTSS
PSTASTKSSGSGKMSYTSPGRQMSQQNLTKQPGLSKNGSSIPRSESASKGLNQTNNSNGS
NKKVELSRMSSTKSSGSESDRSERPILVRQSTFIKEAPSPTLRRKLEESASFESLSPSSR
PDSPTRSQAQTPVLSPSLPDMSLSTHSSVQSGGWRKLPPNLSPTIEYNDGRPAKRHDIAR
SHSESPSRLPINRSGTWKREHSKHSSSLPRVSTWRRTGSSSSILSASSESSEKAKSEDEK
HVNSISGTKQTKENQVSTKGTWRKIKESEISPTNSTSQTTSSGAANGAESKTLIYQMAPA
VSKTEDVWVRIEDCPINNPRSGRSPTGNTPPVIDTVSEKGKQNVGNGSAPVRTVGLENRL
NSFIQVDAPDQKGTEAKPGQSNPVPASETSESSLAERTPFSSSSSSKHSSPSGTVAARVT
PFNYNPSPRKSSADSTSARPSQIPTPVNNNTKKRDSKTDSTESSGTQSPKRHSGSYLVTS
V
NT seq 8466 nt   +upstreamnt  +downstreamnt
atggctgcagcttcatatgatcagttgttaaagcaagttgaggcactgaagatggagaac
tcaaatcttcgacaagagctagaagataattccaatcatcttacaaaactggaaactgag
gcatctaatatgaaggaagtacttaaacagctacaaggaagtattgaagatgaagctatg
gcttcttctggacagattgatttattagagcgtctcaaagaacttaacttagatagcagt
aatttccctggagtgaaactacggtcaaaaatgtccctccgttcttacggaagccgtgaa
ggatctgtatctagtcgttcaggagagtgcagtcctgttcctatgggttcatttccaaga
agagggtttgtaaacggaagcagagaaaacaccggttatttagaagaacttgagaaagag
agatcattacttcttgctgatcttgacaaagaagaaaaggaaaaagactggtattatgct
caacttcagaatctcactaaaagaatagatagtctccctttaaccgaaaatttttcctta
caaacagatatgaccagaagacaattagaatatgaagcaaggcaaatcagagttgcaatg
gaagaacaactaggtacttgccaggatatggaaaaaagagcgcagcgaagagtaaccaga
attcaacaaatagagaaggacatacttcgtatacgacagcttttacagtcccaagcaaca
gaagcagagaggtcatctcagagcaagcatgaagccggctcacatgaagctgagcggcag
agtgaaggtcaaggagtggcagaaatcaacatggcaacttctggtggtggtcagggttca
actacacgaatggatcatgaaacagccagtgttttgagttctagtagcacacactctgct
cctcgaaggttgacaagtcatctgggaaccaaggtggaaatggtgtattcattgttgtca
atgcttggtactcatgataaggatgatatgtcgcgaactttgctggctatgtctagctcc
caagacagctgtatatccatgcggcagtctggatgtcttcctctcctcatccagctctta
catggcaatgacaaagactctgtgttgttgggaaattcccggggcagtaaagaggctcgg
gccagggccagtgcagcacttcacaacatcattcactcacagcctgatgacaagagaggc
aggcgtgaaatccgagtccttcatcttttggaacagatacgagcttactgtgaaacctgt
tgggagtggcaggaagcccatgaacaaggcatggaccaggacaaaaatccaatgccagct
cctgttgaacatcagatctgtcctgctgtgtgtgttctaatgaaactttcatttgatgaa
gagcatagacatgcaatgaatgaacttgggggactacaggccattgcagaattattgcaa
gtggactgtgaaatgtatgggctaactaatgaccactacagtattacattaagacgatat
gctggaatggctttgacaaacttgacttttggagatgtagccaacaaggctacactctgc
tctatgaaaggctgcatgagagctcttgtggcccaactaaaatctgaaagtgaggactta
cagcaggttattgcaagcgttttgaggaatttgtcttggcgggcagatgtaaatagtaaa
aagacattgcgtgaagttggaagtgtgaaagcattgatggaatgtgctctggaagttaaa
aaggaatcaaccctgaaaagcgtattgagtgccttatggaacttgtcagcacattgcact
gagaataaagctgatatatgtgctgtggacggtgcgcttgcgtttctggtcggcactctc
acctaccgaagccagacaaatactttagccattattgaaagtggaggggggatattacgg
aacgtgtccagcttgatagctacaaatgaggaccacaggcaaatcctaagagagaacaac
tgcctgcaaaccttattacaacacttgaaatctcacagtttgacaatagtcagtaatgca
tgtggaactttgtggaatctctcagcaagaaatcctaaagaccaagaagcattatgggac
atgggggcagtcagcatgctcaagaacctcattcattcaaagcacaaaatgattgctatg
ggaagcgctgcggctttaaggaatctcatggcaaatagacctgcaaagtataaggatgcc
aatattatgtctcctggctcaagcttgccatcgcttcatgtcagaaaacaaaaggcccta
gaagccgaattggatgctcagcatttatcagaaacttttgacaatattgacaatttaagt
cccaaggcatctcatcgtaataagcaacgacacaagcaaagtctctatagtgactatgtt
tttgacaccaatcgacatgatgataataggtcagacaattttaatgctggaaacatgacc
gtcctttcaccgtatttaaatactacagtgttgcccagctcttcttcatcaagaggaagt
ttagatagttctcgttctgaaaaagatagaagtttggagagagaacgaggaattagccta
ggcaactaccacccagcaacggaaaatccaggcccttcttcaaagcgaggtttgcagatt
tccaccactgcagcccagattgccaaagtcatggaagaagtatcagccattcacacctcc
caggaagacagaagttctgggtctaccaccgagttacattgtgggacagacgagaggaat
gcactaagaagaagctctactgcccacacacatgcaaacacttacaacttcagtaagtca
gaaaattcaaataggacatgtcctatgccttatgctaaattggaatataagagatcttca
aatgatagtttaaatagtgtcagtagtagtgatggttacggtaaaagaggtcagatgaag
ccttccattgaatcctattctgaggacgatgaaagtaaattttgcagctatggtcaatac
ccagctgacctagcccataaaatacatagtgcaaatcatatggatgacaatgacggagaa
ctagatacgccaataaactacagtcttaagtattcagatgagcagttgaactccggaagg
cagagcccttcacagaatgaaagatgggcaagacccaaacatgtaatagaagatgaaata
aaacagagtgagcaaagacaatcaagaagtcaaagcacaacttaccccgtatacaccgag
agcactgacgataaacacngtgtttccccatataggtcaagaggagccaatggttcagaa
acaaatcgagtaggttctaatcatggaattaatcaaaatgtaaaccagtctttgtgtcag
gaagatgactatgaagatgataagccaaccaactatagtgaacgctactccgaggaagag
caacgtgaggaggaagaaagaccaacaaattacagcataaaatataatgaagacaaacat
catgtggatcagcctattgattatagtttaaaatatgccacagacattgcttcctcacag
aaaccaccattttcattctcaaagaattcatctggacagagcactaaaaccgaacacctc
ccttcaagcagtgagaatacatccacaccttcgtctaatggcaagaggcagaatcagcac
catccaagttcagcacaaagcagaactggtcagaccccaaaagccacctcctgcaaagtt
ccttctatcaaccaagaaacaatacagacgtactgtgtagaggatacaccgatttgtttt
tcacgttgcagttcattatcatctttgtcttcagctgaagatgaaatagggtgtgatcag
gcaacacaggaaacagattctgctaatactctacaaatagccgaaatcaaagaaaacagc
gggactagaacgacagaagattctgtgagtgaagtcccaacagtatcacagcacattaga
accaaatccagcagacttcaggcttctggtttatctgcagaatcaaccaggcataaagct
gttgaattttcttcaggggccaaatctccatcaaaaagtggtgctcagacacctaaaagc
ccaccggagcagtatgtccaggagaccccactcatgtttagccggtgtacttcggtcagc
tcgctcgatagctttgagagtcgttcaattgccagctccgttcagagtgaaccctgcagt
ggaatggtaagtggcattataagccccagtgaccttccagatagccctggacaaaccatg
ccaccaagcagaagtaagacccctccccctcctcctcagacagttcagactaagcgagag
gtacctaaaaacaaagcccctactgcggaaaagcgagagagcggacctaagcaagcagct
gtaaacgctgcggtacagagagtccaggttctcccagatgctgacactctcttacatttt
gccacagaaagtaccccagatggattttcttgttcatctagcctgagtgctctgagcctc
gatgagccatttatacagaaggatgtggaattaagaataatgcctccagttcaggaaaat
gacaatgggaatgaaactgaatccgagcagcctgaggaagcaaatgaaaaccaggaaaaa
gagacagaaaaacctactgattctgaaaaagatctcttagatgactcagatgatgatgat
attgaaatactagaagaatgtattatttctgccatgccaacaaaatcttcacgcaaagcc
aaaaaaccagcccagactgcttccaaattacctccacctgtggcaagaaaaccaagtcag
ctccctgtgtacaaacttcttccatcacaaaacaggttacaagcgcaaaagcacgttagt
tttacaccaggagatgacatgccgcgggtatactgtgtagaagggacacccataaacttt
tccacagctacgtctttaagtgatctaacgatagaatctcccccaaatgagttcgctgct
ggagaaggggttagaacagcggcacagtcaagtgaattcgaaaaacgagataccatccct
acagaaggcagaagtacagatgaggctcaaagaggaaaaaccccatctgtaactatacct
gagccggatgacagtaaaacagaagaaggtgatattcttgcagaatgcattaattctgct
atgcccaaagggaaaagtcacaagccttttcgtgtgaaaaagataatggaccaggtccag
caagcatctatgtcttcatctggagctaacaaaaatcagttagatggtaagaaaaagaaa
cctacttcaccagtaaaacctatgccacaaaatactgaatataggacacgtgtaagaaaa
aatacagactcaaaaaataatttaaatgctgaaagaactttctcagacaacaaagattca
aagaaacagaacttgaaaaataatgccaaggacttcaatgataagctaccaaataatgaa
gatcgagtcagaggaagttttacttttgattcacctcatcactacacgcctattgaagga
actccatactgtttttcacgaaatgattctttgagttctctagattttgatgatgatgat
gttgacctttccagggaaaaggctgaattaagaaaggggaaagaaaataaggaatccgaa
gctaaagttaccagccacacagaactaacctctaaccaacagtcagctaacaaaacacag
gctgttacaaaccatccagtaaatcgaggtcagtctaaacccacgctgcagaagcaatcc
acttttccacagtcgtccaaaggtgcaccggacagaggagcagcaactgatgagaaatta
caaaattttgctcttgaaaatactccagtgtgcttttctcgaaactcctctctaagttct
cttagtgacattgatcaagaaaacaacaataacaaagaaaatgaacctgtcaaagagaca
gagccccctgactcacagggagaaccaagcaaacctcaggcatcaggttacgctcctaaa
tcatttcacgttgaagatacccctgtttgtttctcaagaaacagttctctcagttctctc
agtattgattctgaagatgacctgttgcaggaatgtataagttctgcaatgccgaaaaag
aaaaagccttcaaggcttaagggtgataatgaaaagcatagtcccaggaatatgagtggc
atattagcagaagatttgacactcgatttgaaagatatacagagaccagattcagaacat
ggtttatccccggattcagaaaattttgattggaaggctattcaagaaggtgcaaattcc
atagtaagtagtttacatcaagctgctgctgctgcctgtttatctagacaagcgtcatct
gactcagattccatcctttcactgaaatcaggaatctctctgggatcaccatttcatctt
acacctgatcaagaggaaaagccctttaccagtaataagggcccacgaattctaaaacct
ggggagaagagtacattggaaactaaaaagatagaatctgaaaataaaggaatcaaagga
gggaagaaagtttatagaagtttaattactggaaaaattcgatctcattcagaggtttca
agccaaatgaaacagccccttcaagcaaacatgccttcaatctctcgaggcaggacaatg
attcatattccaggagttcgaaatagctcttcaagtacaagtccagtttctaaaaaaggc
ccaccccttaagactccagcctccaaaagccctagtgaaggtcagacagccaccacttct
cctagaggagccaagccatcagtgaagtcagaattaagccctgtaaccaggcagacatcc
caaccagctggggcaaataaagggccttctagatcaggatctagagattccactccttca
agacctgcccaacaaccattaagtagacctatgcagtctccagggcgaaactcaatttct
cctggtagaaatggaataagtcctcctaacaaattatctcagttgccaaggacttcatcc
cctagtaccgcttcgactaagtcctcgggttctgggaagatgtcatatacatctccaggc
agacagatgagccagcagaaccttaccaaacaaccaggtttatccaagaatggcagtagt
atcccaagaagtgagtctgcctccaaaggactaaatcagacgaataatagcaatggatcc
aataaaaaggtggaactttccagaatgtcttcaactaaatcaagtggaagtgaatctgat
aggtcagagagacccatattagtacgccagtcaactttcatcaaagaagctccaagccca
accctaaggagaaaattggaggaatctgcttcatttgaatctctttctccatcttctaga
ccagattctcccactaggtcccaggcacagactccagttttaagtccttcccttcctgat
atgtctctgtccacacattcatctgttcagtctggtggatggcgaaaactcccacctaat
ctcagtcccaccatagagtataatgatggaagaccggcaaagcgccatgatatagcacgc
tcccattctgaaagtccttctagacttccgattaataggtcaggaacctggaaacgtgag
cacagcaaacattcatcatcccttcctcgagtaagcacttggagaagaactggaagttca
tcttcaattctttctgcttcatcagaatccagtgaaaaggcgaaaagtgaggatgaaaaa
catgtgaactctatttcaggaaccaaacaaactaaagaaaaccaagtatccacaaaagga
acatggagaaaaataaaagaaagtgagatttctcccacaaatagtacctctcagaccact
tcctcaggtgctgcaaatggtgctgaatcaaagactctaatttatcaaatggcacctgct
gtttctaaaacagaggatgtttgggtgagaattgaggactgtcccattaacaaccctaga
tccggaagatctccaacaggaaataccccccctgtgatcgacactgtttcagaaaaggga
aaacaaaatgtggggaatggcagtgctcccgtacgcaccgtgggtttggaaaaccgcctg
aactcctttattcaggtagatgccccagaccaaaaaggaactgaggcaaaaccgggacaa
agtaatcctgtccctgcatcagagactagtgaaagttctctagctgagcgtacaccattc
agttctagcagctcaagcaagcacagttcacctagtgggactgttgctgccagagtgact
cctttcaattacaacccgagccctaggaagagcagtgcagatagcacttcagcgcggccg
tctcagatcccgacaccagtgaacaacaacacaaagaaacgagattcaaaaactgacagc
acagaatccagtggaactcaaagtcctaagcgccattctgggtcttaccttgtgacatct
gtgtaa

DBGET integrated database retrieval system