KEGG   Ursus maritimus (polar bear): 103676495
Entry
103676495         CDS       T03271                                 

Gene name
IGF1
Definition
(RefSeq) insulin like growth factor 1
  KO
K05459  insulin-like growth factor 1
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01521  EGFR tyrosine kinase inhibitor resistance
umr01522  Endocrine resistance
umr04010  MAPK signaling pathway
umr04014  Ras signaling pathway
umr04015  Rap1 signaling pathway
umr04066  HIF-1 signaling pathway
umr04068  FoxO signaling pathway
umr04114  Oocyte meiosis
umr04115  p53 signaling pathway
umr04150  mTOR signaling pathway
umr04151  PI3K-Akt signaling pathway
umr04152  AMPK signaling pathway
umr04211  Longevity regulating pathway
umr04213  Longevity regulating pathway - multiple species
umr04510  Focal adhesion
umr04550  Signaling pathways regulating pluripotency of stem cells
umr04730  Long-term depression
umr04750  Inflammatory mediator regulation of TRP channels
umr04913  Ovarian steroidogenesis
umr04914  Progesterone-mediated oocyte maturation
umr04935  Growth hormone synthesis, secretion and action
umr04960  Aldosterone-regulated sodium reabsorption
umr05200  Pathways in cancer
umr05202  Transcriptional misregulation in cancer
umr05205  Proteoglycans in cancer
umr05214  Glioma
umr05215  Prostate cancer
umr05218  Melanoma
umr05224  Breast cancer
umr05410  Hypertrophic cardiomyopathy
umr05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103676495 (IGF1)
   04014 Ras signaling pathway
    103676495 (IGF1)
   04015 Rap1 signaling pathway
    103676495 (IGF1)
   04066 HIF-1 signaling pathway
    103676495 (IGF1)
   04068 FoxO signaling pathway
    103676495 (IGF1)
   04151 PI3K-Akt signaling pathway
    103676495 (IGF1)
   04152 AMPK signaling pathway
    103676495 (IGF1)
   04150 mTOR signaling pathway
    103676495 (IGF1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103676495 (IGF1)
   04115 p53 signaling pathway
    103676495 (IGF1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103676495 (IGF1)
   04550 Signaling pathways regulating pluripotency of stem cells
    103676495 (IGF1)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    103676495 (IGF1)
   04914 Progesterone-mediated oocyte maturation
    103676495 (IGF1)
   04935 Growth hormone synthesis, secretion and action
    103676495 (IGF1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    103676495 (IGF1)
  09156 Nervous system
   04730 Long-term depression
    103676495 (IGF1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103676495 (IGF1)
  09149 Aging
   04211 Longevity regulating pathway
    103676495 (IGF1)
   04213 Longevity regulating pathway - multiple species
    103676495 (IGF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103676495 (IGF1)
   05202 Transcriptional misregulation in cancer
    103676495 (IGF1)
   05205 Proteoglycans in cancer
    103676495 (IGF1)
  09162 Cancer: specific types
   05214 Glioma
    103676495 (IGF1)
   05218 Melanoma
    103676495 (IGF1)
   05215 Prostate cancer
    103676495 (IGF1)
   05224 Breast cancer
    103676495 (IGF1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    103676495 (IGF1)
   05414 Dilated cardiomyopathy
    103676495 (IGF1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103676495 (IGF1)
   01522 Endocrine resistance
    103676495 (IGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:umr04052]
    103676495 (IGF1)
Cytokines and growth factors [BR:umr04052]
 Growth factors
  Growth factors (RTK binding)
   103676495 (IGF1)
SSDB
Motif
Pfam: Insulin DUF2865
Other DBs
NCBI-GeneID: 103676495
NCBI-ProteinID: XP_008703915
UniProt: A0A384DAX3
LinkDB
Position
Un
AA seq 184 aa
MGKISSLPTQLFKCCFCDFLKVKMHIMSSSHLFYLALCLLTFTSSATAGPETLCGAELVL
CVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARSVRA
QRHTDMPKAQKYRPPSTTKKTKSQRRRKGGPKKRPGGEQKVGTETSQQMKGKKKEQRRET
GARN
NT seq 555 nt   +upstreamnt  +downstreamnt
atgggaaaaatcagcagtcttccaactcaattatttaagtgctgcttttgtgatttcttg
aaggtaaagatgcacatcatgtcctcctcgcatctcttctacctggccctgtgcttgctc
accttcaccagctctgccacagctggaccggagacgctctgtggggctgaattggttctg
tgtgtgtgtggagacaggggtttttatttcaacaagcccacggggtatggctccagcagt
cggagggcacctcagacaggcatcgtggatgagtgctgcttccggagctgtgatctgagg
aggctagagatgtactgcgcacccctcaagcctgccaagtctgcccgctcagtccgtgcc
cagcgccacactgacatgcccaaggctcagaagtatcgtcccccatctaccaccaagaaa
acgaagtctcagaggagaaggaaaggtgggccaaagaaacgcccaggaggggaacagaag
gtggggacggaaacaagtcagcagatgaaaggaaagaagaaagagcagagaagggagact
ggagctagaaactga

DBGET integrated database retrieval system