KEGG   Ursus maritimus (polar bear): 103678843
Entry
103678843         CDS       T03271                                 

Gene name
POGLUT1
Definition
(RefSeq) protein O-glucosyltransferase 1
  KO
K13667  EGF-domain serine glucosyl/xylosyltransferase [EC:2.4.1.376 2.4.2.63]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr00514  Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:umr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    103678843 (POGLUT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:umr01003]
    103678843 (POGLUT1)
Enzymes [BR:umr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.376  EGF-domain serine glucosyltransferase
     103678843 (POGLUT1)
   2.4.2  Pentosyltransferases
    2.4.2.63  EGF-domain serine xylosyltransferase
     103678843 (POGLUT1)
Glycosyltransferases [BR:umr01003]
 O-Glycan biosynthesis
  O-linked Glc type
   103678843 (POGLUT1)
SSDB
Motif
Pfam: Glyco_transf_90
Other DBs
NCBI-GeneID: 103678843
NCBI-ProteinID: XP_008706482
UniProt: A0A384DHG3
LinkDB
Position
Un
AA seq 486 aa
MRWGKADDKRPQTSTGWPLPADKRQSGSCGATQRAEAGRDNHTTRRRFDNTHAWGRPSRW
GGIPSRRRRLYRLDPRQENSLPALKRSKPAGWEQAGKSSKGVQASGCQTPPQPQVPGRQK
ESGSKWKVFIDQINRSLENYEPCSSQNCSCYHGVIDEDLTPFRGGISRKMMAEVVRRKLG
THYQIIKNRLYRENDCMFPSRCSGVEHFILEVIGQLPDMEMVINVRDYPQVPKWMEPAIP
VFSFSKTSEYHDIMYPAWTFWEGGPAVWPIYPTGLGRWDLFREDLVRSAAQWPWKKKNST
AYFRGSRTSPERDPLILLSRKNPKLVDAEYTKNQAWKSMKDTLGKPAAKDVHLVDHCKYK
YLFNFRGVAASFRFKHLFLCRSLVFHVGDEWLEFFYPQLKPWVHYIPVKTDLSNVQELLH
FVKANDDVAQEIAERGSQFIMNHLQMEDVTCYWESLLTEYSKFLSYNVTRRKGYDQIIPK
ILKTEL
NT seq 1461 nt   +upstreamnt  +downstreamnt
atgaggtgggggaaggcggacgacaagagaccacaaacttcaacaggctggcccctacca
gcggacaaacgacaaagcggttcctgcggcgcaacccagagagctgaagcaggccgggac
aatcacacaacgcggaggaggttcgataatactcacgcatgggggaggcccagccggtgg
ggcgggatccctagcagaaggcggcggctttacaggctggaccccaggcaagagaattcc
ctccctgcgttgaagcgctccaaaccagctggctgggagcaggccggaaagtcgagtaaa
ggtgtccaggcttcgggctgccagaccccgccccagccccaggtgccgggccgccagaag
gagtcaggttcaaaatggaaagtatttattgaccaaattaacaggtctttggagaattat
gaaccatgttcaagtcaaaattgcagctgctaccatggggtcatagatgaagatctgact
cctttccgaggaggtatctccaggaagatgatggcggaggtagtcagacggaaactaggg
acccactatcagatcattaagaacagattataccgagagaatgactgcatgttcccttca
agatgtagtggtgttgaacactttattttggaagttatcgggcagcttccggacatggaa
atggtgatcaatgtacgagattatcctcaggttcctaaatggatggagcctgccattcca
gtcttctccttcagtaagacatcagagtaccatgatatcatgtatcctgcttggacattc
tgggaagggggacccgctgtctggccaatttatcctacaggtcttggacggtgggacctc
ttcagagaagatcttgtaaggtcagcagcacagtggccatggaaaaagaaaaattctaca
gcatatttccgaggatcaaggacaagtccagaacgagatcctctcattcttctatctcgg
aaaaatccaaaacttgttgatgcagaatacaccaaaaaccaggcctggaaatctatgaaa
gataccttagggaagccagctgctaaggatgtccatcttgtggatcactgcaaatacaag
tatctgtttaattttcgaggcgtagctgcaagtttccgcttcaaacacctcttcctgtgt
cgttcacttgttttccatgttggtgatgagtggctggaattcttctatccacagctgaag
ccgtgggttcactatatcccagtcaaaacagatctctccaatgtccaggagttgttgcat
tttgtgaaagcaaatgatgatgtggctcaagaaattgctgagaggggaagccagtttatt
atgaaccatttgcagatggaagatgtcacctgttactgggagagcctgttgactgaatac
tctaaattcctgtcctataatgtaacaagaaggaaaggctatgatcagattattcccaaa
attttgaaaactgaactctag

DBGET integrated database retrieval system