KEGG   Ursus maritimus (polar bear): 103678897
Entry
103678897         CDS       T03271                                 

Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 9-like
Organism
umr  Ursus maritimus (polar bear)
SSDB
Motif
Pfam: Ricin_B_lectin
Other DBs
NCBI-GeneID: 103678897
NCBI-ProteinID: XP_008706549
UniProt: A0A384DIC5
LinkDB
Position
Un
AA seq 105 aa
LVRYSAEGLLQLGPEGSTAFLPDSKCLVDDGRTRVPALKKCEDVARPAQXTWSPSPQSGP
IVSRDTGRCLEVEMSKDANFGLRLVVQRCSGQKWTIRNWIKRGRQ
NT seq 318 nt   +upstreamnt  +downstreamnt
ctggtgcggtacagcgcagaggggctgctgcagctgggccccgagggctccaccgccttc
ctgcccgactccaagtgcctggtggacgacggcaggacccgcgtgcccgctctgaagaag
tgcgaggacgtggcccggcccgcacagcngacctggtccccctccccgcagagtggcccc
atcgtgagccgggacaccggcaggtgcctggaggtggaaatgtccaaggacgccaacttc
gggctgcggctggtggtacagaggtgttcggggcagaagtggaccatcagaaactggatc
aagcgtgggcggcagtga

DBGET integrated database retrieval system